2024-11-15 17:17:44, GGRNA.v2 : RefSeq release 226 (Sep, 2024)
LOCUS XM_009084206 324 bp mRNA linear VRT 05-SEP-2014 DEFINITION PREDICTED: Acanthisitta chloris VCP-interacting membrane protein (VIMP), partial mRNA. ACCESSION XM_009084206 VERSION XM_009084206.1 DBLINK BioProject: PRJNA253841 KEYWORDS RefSeq. SOURCE Acanthisitta chloris (rifleman) ORGANISM Acanthisitta chloris Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Neoaves; Telluraves; Australaves; Passeriformes; Acanthisittidae; Acanthisitta. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_008656221.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Version :: Acanthisitta chloris Annotation Release 100 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 6.1 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## COMPLETENESS: incomplete on the 5' end. FEATURES Location/Qualifiers source 1..324 /organism="Acanthisitta chloris" /mol_type="mRNA" /isolate="BGI_N310" /db_xref="taxon:57068" /chromosome="Unknown" /sex="female" /geo_loc_name="New Zealand" gene <1..324 /gene="VIMP" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 Proteins" /db_xref="GeneID:103811246" CDS <1..324 /gene="VIMP" /codon_start=1 /product="selenoprotein S" /protein_id="XP_009082454.1" /db_xref="GeneID:103811246" /translation="
EALAAARLRMQEELNAQAERYKEKQKQLEEEKRRQKIAMWESMQEGKSYKGNLKLNQQGESGASTSAVPKSKPNKKPLRGGGYNPLSGEGGGTCSWRPGRRGPSAGG"
misc_feature <1..321 /gene="VIMP" /note="Selenoprotein S (SelS); Region: Selenoprotein_S; pfam06936" /db_xref="CDD:462043" ORIGIN
gaggccttggcagcagctcgcctcaggatgcaggaggagttgaatgcacaagcagaaagatacaaagaaaaacaaaaacagcttgaagaggagaagcgaaggcagaagatagcaatgtgggaaagtatgcaagaaggaaagagctacaaaggaaatctgaaactgaatcagcaaggagaatctggtgcctccacctcagcagtcccaaaatctaaaccaaacaaaaagcctttgcgaggaggtgggtataacccactgtctggagaaggaggaggaacctgttcctggagaccaggccggagaggcccatcagcaggtggatga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]