LOCUS       XM_009084206             324 bp    mRNA    linear   VRT 05-SEP-2014
DEFINITION  PREDICTED: Acanthisitta chloris VCP-interacting membrane protein
            (VIMP), partial mRNA.
ACCESSION   XM_009084206
VERSION     XM_009084206.1
DBLINK      BioProject: PRJNA253841
KEYWORDS    RefSeq.
SOURCE      Acanthisitta chloris (rifleman)
  ORGANISM  Acanthisitta chloris
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
            Coelurosauria; Aves; Neognathae; Neoaves; Telluraves; Australaves;
            Passeriformes; Acanthisittidae; Acanthisitta.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_008656221.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Acanthisitta chloris Annotation
                                           Release 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 6.1
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on the 5' end.
FEATURES             Location/Qualifiers
     source          1..324
                     /organism="Acanthisitta chloris"
                     /mol_type="mRNA"
                     /isolate="BGI_N310"
                     /db_xref="taxon:57068"
                     /chromosome="Unknown"
                     /sex="female"
                     /geo_loc_name="New Zealand"
     gene            <1..324
                     /gene="VIMP"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 4 Proteins"
                     /db_xref="GeneID:103811246"
     CDS             <1..324
                     /gene="VIMP"
                     /codon_start=1
                     /product="selenoprotein S"
                     /protein_id="XP_009082454.1"
                     /db_xref="GeneID:103811246"
                     /translation="

EALAAARLRMQEELNAQAERYKEKQKQLEEEKRRQKIAMWESMQEGKSYKGNLKLNQQGESGASTSAVPKSKPNKKPLRGGGYNPLSGEGGGTCSWRPGRRGPSAGG"

     misc_feature    <1..321
                     /gene="VIMP"
                     /note="Selenoprotein S (SelS); Region: Selenoprotein_S;
                     pfam06936"
                     /db_xref="CDD:462043"
ORIGIN      

gaggccttggcagcagctcgcctcaggatgcaggaggagttgaatgcacaagcagaaagatacaaagaaaaacaaaaacagcttgaagaggagaagcgaaggcagaagatagcaatgtgggaaagtatgcaagaaggaaagagctacaaaggaaatctgaaactgaatcagcaaggagaatctggtgcctccacctcagcagtcccaaaatctaaaccaaacaaaaagcctttgcgaggaggtgggtataacccactgtctggagaaggaggaggaacctgttcctggagaccaggccggagaggcccatcagcaggtggatga

//