LOCUS       XM_008949822             384 bp    mRNA    linear   VRT 02-SEP-2014
DEFINITION  PREDICTED: Merops nubicus VCP-interacting membrane protein (VIMP),
            partial mRNA.
ACCESSION   XM_008949822
VERSION     XM_008949822.1
DBLINK      BioProject: PRJNA253837
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Merops nubicus (carmine bee-eater)
  ORGANISM  Merops nubicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
            Coelurosauria; Aves; Neognathae; Neoaves; Telluraves;
            Coraciimorphae; Coraciiformes; Meropidae; Merops.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_008590153.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Merops nubicus Annotation Release
                                           100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 6.1
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 5% of CDS bases
            ##RefSeq-Attributes-END##
            COMPLETENESS: incomplete on the 5' end.
FEATURES             Location/Qualifiers
     source          1..384
                     /organism="Merops nubicus"
                     /mol_type="mRNA"
                     /isolate="BGI_N331"
                     /db_xref="taxon:57421"
                     /chromosome="Unknown"
                     /sex="female"
     gene            <1..384
                     /gene="VIMP"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 5 Proteins"
                     /db_xref="GeneID:103782077"
     CDS             <1..384
                     /gene="VIMP"
                     /codon_start=1
                     /product="selenoprotein S"
                     /protein_id="XP_008948070.1"
                     /db_xref="GeneID:103782077"
                     /translation="

LCNLFPHSLEPDVVVRRQEALAAARLRMQEELNAQAERYKEKQRQLEEEKRRQKIAMWESMQEGKSYKGNLKLNQQEVESGASTSSAVPKSKPNKKPLRGGGYNPLSGEGGGTCSWRPGRRGPSAGG"

     misc_feature    <22..381
                     /gene="VIMP"
                     /note="Selenoprotein S (SelS); Region: Selenoprotein_S;
                     pfam06936"
                     /db_xref="CDD:462043"
ORIGIN      

ctttgtaacctctttccccattccctagaacctgacgtggtggtaagaaggcaggaagctttggcagcagctcgcctcaggatgcaagaggagctgaatgcacaagcagagagatacaaagaaaagcaaagacagcttgaagaagagaagcgaaggcagaagatcgccatgtgggagagtatgcaagaaggaaaaagctacaaaggaaacctgaagctgaatcagcaagaagtagaatctggtgcctccacctcatcagcagtcccaaaatctaaaccaaacaaaaagcccttacgaggaggtggctacaaccctctgtctggagaaggaggtgggacgtgctcctggcggccaggccggcgaggcccctcggcgggaggatga

//