GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-11-15 17:47:33, GGRNA.v2 : RefSeq release 226 (Sep, 2024)

LOCUS       XM_007374654             300 bp    mRNA    linear   PLN 29-DEC-2023
DEFINITION  Spathaspora passalidarum NRRL Y-27907 uncharacterized protein
            (SPAPADRAFT_55114), partial mRNA.
ACCESSION   XM_007374654
VERSION     XM_007374654.1
DBLINK      BioProject: PRJNA225527
            BioSample: SAMN00714472
KEYWORDS    RefSeq.
SOURCE      Spathaspora passalidarum NRRL Y-27907
  ORGANISM  Spathaspora passalidarum NRRL Y-27907
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Pichiomycetes; Debaryomycetaceae; Spathaspora.
REFERENCE   1  (bases 1 to 300)
  AUTHORS   Wohlbach,D.J., Kuo,A., Sato,T.K., Potts,K.M., Salamov,A.A.,
            Labutti,K.M., Sun,H., Clum,A., Pangilinan,J.L., Lindquist,E.A.,
            Lucas,S., Lapidus,A., Jin,M., Gunawan,C., Balan,V., Dale,B.E.,
            Jeffries,T.W., Zinkel,R., Barry,K.W., Grigoriev,I.V. and Gasch,A.P.
  TITLE     Comparative genomics of xylose-fermenting fungi for enhanced
            biofuel production
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 108 (32), 13212-13217 (2011)
   PUBMED   21788494
REFERENCE   2  (bases 1 to 300)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (28-DEC-2023) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 300)
  AUTHORS   Kuo,A., LaButti,K.M., Sun,H., Clum,A., Pangilinan,J., Lindquist,E.,
            Barry,K., Lucas,S., Lapidus,A., Wohlbach,D.J., Potts,K.M.,
            Jeffries,T.W., Zinkel,R., Gasch,A.P. and Grigoriev,I.V.
  CONSRTM   US DOE Joint Genome Institute (JGI-PGF)
  TITLE     Direct Submission
  JOURNAL   Submitted (10-MAY-2011) US DOE Joint Genome Institute, 2800
            Mitchell Drive, Walnut Creek, CA 94598-1698, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NW_006767427).
            
            ##Metadata-START##
            Organism Display Name :: Spathaspora passalidarum NRRL Y-27907
            GOLD Stamp ID         :: Gi04859
            ##Metadata-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..300
                     /organism="Spathaspora passalidarum NRRL Y-27907"
                     /mol_type="mRNA"
                     /strain="NRRL Y-27907"
                     /type_material="type material of Spathaspora passalidarum"
                     /db_xref="taxon:619300"
                     /chromosome="Unknown"
     gene            <1..>300
                     /locus_tag="SPAPADRAFT_55114"
                     /db_xref="GeneID:18871909"
     CDS             1..300
                     /locus_tag="SPAPADRAFT_55114"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_007374716.1"
                     /db_xref="GeneID:18871909"
                     /db_xref="InterPro:IPR000509"
                     /db_xref="JGIDB:Spapa3_55114"
                     /translation="
MAKSGIAAGLNKGHKTTAKEVAPKVSYRKGALSKRADFVRNIVKEVAGLAPYERRLIELIRNAGEKRAKKLAKKRLGTHKRALRKVEEMNKVIAESRRH"
     misc_feature    7..294
                     /locus_tag="SPAPADRAFT_55114"
                     /note="Ribosomal protein L36e; Region: Ribosomal_L36e;
                     pfam01158"
                     /db_xref="CDD:460088"
ORIGIN      
atggctaagtcaggtattgctgctggtttaaacaagggtcacaagactaccgctaaggaagtcgctccaaaggtttcctacagaaagggtgctttaagtaagagagctgactttgtcagaaacatcgtcaaggaagttgctggtttagccccatacgaaagaagattgattgaattgatcagaaacgccggtgaaaagagagctaagaagttggccaagaagagattgggtacccacaagagagctttaagaaaggttgaagaaatgaacaaggtcattgctgaatctagaagacactaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]