2025-04-20 13:46:31, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS XM_006510814 1015 bp mRNA linear ROD 07-FEB-2024 DEFINITION PREDICTED: Mus musculus glutathione S-transferase, alpha 2 (Yc2) (Gsta2), transcript variant X1, mRNA. ACCESSION XM_006510814 VERSION XM_006510814.2 DBLINK BioProject: PRJNA169 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_000075.7) annotated using gene prediction method: Gnomon, supported by mRNA and EST evidence. Also see: Documentation of NCBI's Annotation Process On Feb 9, 2015 this sequence version replaced XM_006510814.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Updated annotation Annotation Name :: GCF_000001635.27-RS_2024_02 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.2 Annotation Method :: Best-placed RefSeq; Gnomon; RefSeqFE; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 02/01/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1015 /organism="Mus musculus" /mol_type="mRNA" /strain="C57BL/6J" /db_xref="taxon:10090" /chromosome="9" gene 1..1015 /gene="Gsta2" /gene_synonym="Gst2-2; Gstc-2; Gstc2" /note="glutathione S-transferase, alpha 2 (Yc2); Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 mRNA, 33 ESTs, 6 long SRA reads, 47 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 10 samples with support for all annotated introns" /db_xref="GeneID:14858" /db_xref="MGI:MGI:95863" CDS 238..906 /gene="Gsta2" /gene_synonym="Gst2-2; Gstc-2; Gstc2" /codon_start=1 /product="glutathione S-transferase A2 isoform X1" /protein_id="XP_006510877.1" /db_xref="GeneID:14858" /db_xref="MGI:MGI:95863" /translation="
MAGKPVLHYFNARGRMECIRWLLAAAGVEFEEKFIQSPEDLEKLKKDGNLMFDQVPMVEIDGMKLVQTRAILNYIATKYDLYGKDMKERALIDMYTEGILDLTEMIGQLVLCPPDQREAKTALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDVHLLELLLYVEELDASLLTPFPLLKAFKSRISSLPNVKKFLHPGSQRKPPLDAKQIEEARKVFKF"
misc_feature 247..483 /gene="Gsta2" /gene_synonym="Gst2-2; Gstc-2; Gstc2" /note="GST_N family, Class Alpha subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens; Region: GST_N_Alpha; cd03077" /db_xref="CDD:239375" misc_feature order(268..270,274..276,280..282,286..291,298..300, 307..312,331..333,343..345,442..444,451..456) /gene="Gsta2" /gene_synonym="Gst2-2; Gstc-2; Gstc2" /note="C-terminal domain interface [polypeptide binding]; other site" /db_xref="CDD:239375" misc_feature order(370..372,397..402,436..441) /gene="Gsta2" /gene_synonym="Gst2-2; Gstc-2; Gstc2" /note="GSH binding site (G-site) [chemical binding]; other site" /db_xref="CDD:239375" misc_feature order(391..396,418..420,433..438,442..447,454..459, 469..471) /gene="Gsta2" /gene_synonym="Gst2-2; Gstc-2; Gstc2" /note="dimer interface [polypeptide binding]; other site" /db_xref="CDD:239375" misc_feature 493..897 /gene="Gsta2" /gene_synonym="Gst2-2; Gstc-2; Gstc2" /note="C-terminal, alpha helical domain of Class Alpha Glutathione S-transferases; Region: GST_C_Alpha; cd03208" /db_xref="CDD:198317" misc_feature order(493..498,502..504,514..522,526..531,538..540, 628..630) /gene="Gsta2" /gene_synonym="Gst2-2; Gstc-2; Gstc2" /note="dimer interface [polypeptide binding]; other site" /db_xref="CDD:198317" misc_feature order(526..528,547..549,556..558,565..570,628..633, 640..642,691..702,709..711,718..723,730..735,742..744, 814..819,823..840) /gene="Gsta2" /gene_synonym="Gst2-2; Gstc-2; Gstc2" /note="N-terminal domain interface [polypeptide binding]; other site" /db_xref="CDD:198317" misc_feature order(538..540,556..558,568..570,628..630,859..861, 883..885,895..897) /gene="Gsta2" /gene_synonym="Gst2-2; Gstc-2; Gstc2" /note="substrate binding pocket (H-site) [chemical binding]; other site" /db_xref="CDD:198317" ORIGIN
ggtccctatactgggtaagaattgttgccttactaaagtagcgtgcacactcctctggagctggattgggagctgagtggagaagaagccaggactctcactagggtttctattccttgcttcttgagcaagttggaggaaaaaaggatttattcagcttatacttccacattgccgttcatcaccaaagaaagtccggaccggaactcaagcagaccgtgaaccacagttgctgcaatggccgggaagcccgtgcttcactacttcaatgcccggggcagaatggagtgcatcaggtggctcctggctgcagcaggggtggagtttgaagagaagtttatacagagtccggaagatttggaaaagctaaaaaaagatgggaatttgatgtttgaccaagtgcccatggtggagattgatgggatgaagctggtgcagaccagagccattctcaactacatcgccaccaaatatgacctctatgggaaggacatgaaggagagagccctgattgacatgtatacagaaggtattttagatctgactgaaatgattgggcaattggtattatgtcccccagaccaaagagaagccaagactgccttggcaaaagacaggaccaaaaaccgttacttgcctgcctttgaaaaggtgttgaagagccatggacaagactaccttgtgggcaacaggctgaccagggtggacgtccacctgctggaacttcttctctatgttgaagagcttgatgccagccttctgacccctttccctctgctgaaggccttcaagagcagaatcagcagcctccccaatgtgaagaagttcctacatcctggcagccagagaaagcctcccttggatgcaaaacaaattgaagaagcaaggaaggttttcaagttttagtgtggctgcattgatggagccacagatactggcctctaattgtttgcaattataaaatacaattgttgattctggctattgtgcaataataaaaaattaacaactggta
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]