GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-04-20 13:46:31, GGRNA.v2 : RefSeq release 229 (Mar, 2025)

LOCUS       XM_006510814            1015 bp    mRNA    linear   ROD 07-FEB-2024
DEFINITION  PREDICTED: Mus musculus glutathione S-transferase, alpha 2 (Yc2)
            (Gsta2), transcript variant X1, mRNA.
ACCESSION   XM_006510814
VERSION     XM_006510814.2
DBLINK      BioProject: PRJNA169
KEYWORDS    RefSeq.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_000075.7) annotated using gene prediction method: Gnomon,
            supported by mRNA and EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Feb 9, 2015 this sequence version replaced XM_006510814.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Updated annotation
            Annotation Name             :: GCF_000001635.27-RS_2024_02
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.2
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           RefSeqFE; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 02/01/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1015
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="C57BL/6J"
                     /db_xref="taxon:10090"
                     /chromosome="9"
     gene            1..1015
                     /gene="Gsta2"
                     /gene_synonym="Gst2-2; Gstc-2; Gstc2"
                     /note="glutathione S-transferase, alpha 2 (Yc2); Derived
                     by automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 1 mRNA, 33 ESTs, 6 long SRA reads, 47 Proteins, and
                     100% coverage of the annotated genomic feature by RNAseq
                     alignments, including 10 samples with support for all
                     annotated introns"
                     /db_xref="GeneID:14858"
                     /db_xref="MGI:MGI:95863"
     CDS             238..906
                     /gene="Gsta2"
                     /gene_synonym="Gst2-2; Gstc-2; Gstc2"
                     /codon_start=1
                     /product="glutathione S-transferase A2 isoform X1"
                     /protein_id="XP_006510877.1"
                     /db_xref="GeneID:14858"
                     /db_xref="MGI:MGI:95863"
                     /translation="
MAGKPVLHYFNARGRMECIRWLLAAAGVEFEEKFIQSPEDLEKLKKDGNLMFDQVPMVEIDGMKLVQTRAILNYIATKYDLYGKDMKERALIDMYTEGILDLTEMIGQLVLCPPDQREAKTALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDVHLLELLLYVEELDASLLTPFPLLKAFKSRISSLPNVKKFLHPGSQRKPPLDAKQIEEARKVFKF"
     misc_feature    247..483
                     /gene="Gsta2"
                     /gene_synonym="Gst2-2; Gstc-2; Gstc2"
                     /note="GST_N family, Class Alpha subfamily; GSTs are
                     cytosolic dimeric proteins involved in cellular
                     detoxification by catalyzing the conjugation of
                     glutathione (GSH) with a wide range of endogenous and
                     xenobiotic alkylating agents, including carcinogens;
                     Region: GST_N_Alpha; cd03077"
                     /db_xref="CDD:239375"
     misc_feature    order(268..270,274..276,280..282,286..291,298..300,
                     307..312,331..333,343..345,442..444,451..456)
                     /gene="Gsta2"
                     /gene_synonym="Gst2-2; Gstc-2; Gstc2"
                     /note="C-terminal domain interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:239375"
     misc_feature    order(370..372,397..402,436..441)
                     /gene="Gsta2"
                     /gene_synonym="Gst2-2; Gstc-2; Gstc2"
                     /note="GSH binding site (G-site) [chemical binding]; other
                     site"
                     /db_xref="CDD:239375"
     misc_feature    order(391..396,418..420,433..438,442..447,454..459,
                     469..471)
                     /gene="Gsta2"
                     /gene_synonym="Gst2-2; Gstc-2; Gstc2"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:239375"
     misc_feature    493..897
                     /gene="Gsta2"
                     /gene_synonym="Gst2-2; Gstc-2; Gstc2"
                     /note="C-terminal, alpha helical domain of Class Alpha
                     Glutathione S-transferases; Region: GST_C_Alpha; cd03208"
                     /db_xref="CDD:198317"
     misc_feature    order(493..498,502..504,514..522,526..531,538..540,
                     628..630)
                     /gene="Gsta2"
                     /gene_synonym="Gst2-2; Gstc-2; Gstc2"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:198317"
     misc_feature    order(526..528,547..549,556..558,565..570,628..633,
                     640..642,691..702,709..711,718..723,730..735,742..744,
                     814..819,823..840)
                     /gene="Gsta2"
                     /gene_synonym="Gst2-2; Gstc-2; Gstc2"
                     /note="N-terminal domain interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:198317"
     misc_feature    order(538..540,556..558,568..570,628..630,859..861,
                     883..885,895..897)
                     /gene="Gsta2"
                     /gene_synonym="Gst2-2; Gstc-2; Gstc2"
                     /note="substrate binding pocket (H-site) [chemical
                     binding]; other site"
                     /db_xref="CDD:198317"
ORIGIN      
ggtccctatactgggtaagaattgttgccttactaaagtagcgtgcacactcctctggagctggattgggagctgagtggagaagaagccaggactctcactagggtttctattccttgcttcttgagcaagttggaggaaaaaaggatttattcagcttatacttccacattgccgttcatcaccaaagaaagtccggaccggaactcaagcagaccgtgaaccacagttgctgcaatggccgggaagcccgtgcttcactacttcaatgcccggggcagaatggagtgcatcaggtggctcctggctgcagcaggggtggagtttgaagagaagtttatacagagtccggaagatttggaaaagctaaaaaaagatgggaatttgatgtttgaccaagtgcccatggtggagattgatgggatgaagctggtgcagaccagagccattctcaactacatcgccaccaaatatgacctctatgggaaggacatgaaggagagagccctgattgacatgtatacagaaggtattttagatctgactgaaatgattgggcaattggtattatgtcccccagaccaaagagaagccaagactgccttggcaaaagacaggaccaaaaaccgttacttgcctgcctttgaaaaggtgttgaagagccatggacaagactaccttgtgggcaacaggctgaccagggtggacgtccacctgctggaacttcttctctatgttgaagagcttgatgccagccttctgacccctttccctctgctgaaggccttcaagagcagaatcagcagcctccccaatgtgaagaagttcctacatcctggcagccagagaaagcctcccttggatgcaaaacaaattgaagaagcaaggaaggttttcaagttttagtgtggctgcattgatggagccacagatactggcctctaattgtttgcaattataaaatacaattgttgattctggctattgtgcaataataaaaaattaacaactggta
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]