2025-02-23 08:37:43, GGRNA.v2 : RefSeq release 228 (Jan, 2025)
LOCUS XM_003676917 531 bp mRNA linear PLN 04-DEC-2024 DEFINITION Naumovozyma castellii uncharacterized protein (NCAS0F01260), partial mRNA. ACCESSION XM_003676917 VERSION XM_003676917.1 DBLINK BioProject: PRJNA79343 BioSample: SAMEA2271985 KEYWORDS RefSeq. SOURCE Naumovozyma castellii ORGANISM Naumovozyma castellii Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Naumovozyma. REFERENCE 1 AUTHORS Gordon,J.L., Armisen,D., Proux-Wera,E., OhEigeartaigh,S.S., Byrne,K.P. and Wolfe,K.H. TITLE Evolutionary erosion of yeast sex chromosomes by mating-type switching accidents JOURNAL Proc. Natl. Acad. Sci. U.S.A. 108 (50), 20024-20029 (2011) PUBMED 22123960 REFERENCE 2 (bases 1 to 531) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (03-DEC-2024) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 531) AUTHORS Byrne,K. TITLE Direct Submission JOURNAL Submitted (11-JUL-2011) Smurfit Institute of Genetics, Trinity College Dublin, College Green, Dublin 2, IRELAND COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NC_016496). COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..531 /organism="Naumovozyma castellii" /mol_type="mRNA" /strain="type strain:CBS 4309" /db_xref="taxon:27288" /chromosome="6" gene <1..>531 /gene="NCAS0F01260" /locus_tag="NCAS_0F01260" /db_xref="GeneID:96904258" CDS 1..531 /gene="NCAS0F01260" /locus_tag="NCAS_0F01260" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_003676965.1" /db_xref="GeneID:96904258" /db_xref="UniProtKB/TrEMBL:G0VGI9" /translation="
MGWHAQTNTLYAGSVNLYGGQVYLWQGDIPSTSMSNKSCNRRSCMFPKRANACIRKLKREMILRQSQRVNKGTLVNSQYSRKRLVNLFLFSKDQVRVSCGTFSKKKPLLQRASTPPQLFFHNCVHTCSISLRRRTYSVQFGQLVTDTTKTMFSLGLSHPGFSLLQIILYPFLSAVS"
ORIGIN
atgggctggcatgctcaaaccaacaccttgtatgctggtagtgtaaatctttacgggggacaagtgtacctttggcaaggtgacataccttccacatccatgtcaaacaaaagctgtaaccgccgatcgtgtatgtttcccaaaagggcaaatgcctgcatacgtaagctgaaacgggaaatgattctcagacaatcacagcgcgtaaacaaaggcacgctagtgaatagccaatatagtcgcaaaagactagtcaatctcttcttgttctcgaaggatcaggtcagggtttcttgtggcacattctctaaaaagaaacctcttcttcagcgtgccagcaccccccctcaacttttttttcacaattgcgtacatacgtgtagtatttctctaagaagaagaacatactcagtacaatttggacagctcgttaccgatactaccaaaactatgttctctttgggtttatcgcaccctggattctcgcttttacagattatactgtatccttttctttcggcggttagctaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]