2025-09-15 14:35:59, GGRNA.v2 : RefSeq release 231 (Jul, 2025)
LOCUS XM_001383429 288 bp mRNA linear PLN 05-JUN-2017 DEFINITION Scheffersomyces stipitis CBS 6054 60S ribosomal protein L36 partial mRNA. ACCESSION XM_001383429 VERSION XM_001383429.1 DBLINK BioProject: PRJNA18881 BioSample: SAMN02746101 KEYWORDS RefSeq. SOURCE Scheffersomyces stipitis CBS 6054 (Pichia stipitis CBS 6054) ORGANISM Scheffersomyces stipitis CBS 6054 Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Pichiomycetes; Debaryomycetaceae; Scheffersomyces. REFERENCE 1 (bases 1 to 288) AUTHORS Jeffries,T.W., Grigoriev,I.V., Grimwood,J., Laplaza,J.M., Aerts,A., Salamov,A., Schmutz,J., Lindquist,E., Dehal,P., Shapiro,H., Jin,Y.S., Passoth,V. and Richardson,P.M. TITLE Genome sequence of the lignocellulose-bioconverting and xylose-fermenting yeast Pichia stipitis JOURNAL Nat. Biotechnol. 25 (3), 319-326 (2007) PUBMED 17334359 REFERENCE 2 (bases 1 to 288) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (05-JUN-2017) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 288) AUTHORS Grigoriev,I., Grimwood,J., Aerts,A., Salamov,A., Zhou,K., Lou,Y., Pitluck,S., Schmutz,J., Myers,R.M., Lucas,S., Detter,J.C., Glavina del Rio,T., Jin,Y.-S., Passoth,V., Laplaza,J.M., Jeffries,T.W. and Richardson,P. CONSRTM US DOE Joint Genome Institute TITLE Direct Submission JOURNAL Submitted (12-DEC-2006) US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA 94598-1698, USA COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NC_009043). COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..288 /organism="Scheffersomyces stipitis CBS 6054" /mol_type="mRNA" /strain="CBS 6054" /db_xref="taxon:322104" /chromosome="3" gene <1..>288 /locus_tag="PICST_43155" /db_xref="GeneID:4838027" CDS <1..288 /locus_tag="PICST_43155" /note="go_component intracellular; ribosome; go_function structural constituent of ribosome; go_process protein biosynthesis" /codon_start=1 /transl_table=12 /product="60S ribosomal protein L36" /protein_id="XP_001383466.1" /db_xref="GeneID:4838027" /db_xref="InterPro:IPR00050" /db_xref="JGIDB:Picst3_43155" /translation="
GIAVGLNKGHKTTAKEVAPKISYRKGALSKRTDFVRNIVKEVAGLAPYERRLIELIRNAGEKRAKKLAKKRLGTHKRALKKVEEMNKVIAETRRH"
misc_feature 1..282 /locus_tag="PICST_43155" /note="Ribosomal protein L36e; Region: Ribosomal_L36e; pfam01158" /db_xref="CDD:460088" ORIGIN
ggaattgctgttggattaaacaagggtcacaagactaccgctaaggaagttgctccaaagatctcttacagaaagggtgctctttccaagagaaccgacttcgtcagaaacatcgtcaaggaagttgctggcttagccccatacgaaagaagattgatcgaattgatcagaaacgccggtgaaaagagagctaagaagttggccaagaagagattgggtacccacaagagagccttgaagaaggttgaagaaatgaacaaggtcattgctgaaaccagaagacactaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]