GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-12-18 06:04:40, GGRNA.v2 : RefSeq release 232 (Sep, 2025)

LOCUS       NM_120659                429 bp    mRNA    linear   PLN 20-OCT-2022
DEFINITION  Arabidopsis thaliana WUSCHEL related homeobox 7 (WOX7), partial
            mRNA.
ACCESSION   NM_120659
VERSION     NM_120659.2
DBLINK      BioProject: PRJNA116
            BioSample: SAMN03081427
KEYWORDS    RefSeq.
SOURCE      Arabidopsis thaliana (thale cress)
  ORGANISM  Arabidopsis thaliana
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; malvids; Brassicales; Brassicaceae;
            Camelineae; Arabidopsis.
REFERENCE   1  (bases 1 to 429)
  AUTHORS   Tabata,S., Kaneko,T., Nakamura,Y., Kotani,H., Kato,T., Asamizu,E.,
            Miyajima,N., Sasamoto,S., Kimura,T., Hosouchi,T., Kawashima,K.,
            Kohara,M., Matsumoto,M., Matsuno,A., Muraki,A., Nakayama,S.,
            Nakazaki,N., Naruo,K., Okumura,S., Shinpo,S., Takeuchi,C., Wada,T.,
            Watanabe,A., Yamada,M., Yasuda,M., Sato,S., de la Bastide,M.,
            Huang,E., Spiegel,L., Gnoj,L., O'Shaughnessy,A., Preston,R.,
            Habermann,K., Murray,J., Johnson,D., Rohlfing,T., Nelson,J.,
            Stoneking,T., Pepin,K., Spieth,J., Sekhon,M., Armstrong,J.,
            Becker,M., Belter,E., Cordum,H., Cordes,M., Courtney,L.,
            Courtney,W., Dante,M., Du,H., Edwards,J., Fryman,J., Haakensen,B.,
            Lamar,E., Latreille,P., Leonard,S., Meyer,R., Mulvaney,E.,
            Ozersky,P., Riley,A., Strowmatt,C., Wagner-McPherson,C., Wollam,A.,
            Yoakum,M., Bell,M., Dedhia,N., Parnell,L., Shah,R., Rodriguez,M.,
            See,L.H., Vil,D., Baker,J., Kirchoff,K., Toth,K., King,L.,
            Bahret,A., Miller,B., Marra,M., Martienssen,R., McCombie,W.R.,
            Wilson,R.K., Murphy,G., Bancroft,I., Volckaert,G., Wambutt,R.,
            Dusterhoft,A., Stiekema,W., Pohl,T., Entian,K.D., Terryn,N.,
            Hartley,N., Bent,E., Johnson,S., Langham,S.A., McCullagh,B.,
            Robben,J., Grymonprez,B., Zimmermann,W., Ramsperger,U., Wedler,H.,
            Balke,K., Wedler,E., Peters,S., van Staveren,M., Dirkse,W.,
            Mooijman,P., Lankhorst,R.K., Weitzenegger,T., Bothe,G., Rose,M.,
            Hauf,J., Berneiser,S., Hempel,S., Feldpausch,M., Lamberth,S.,
            Villarroel,R., Gielen,J., Ardiles,W., Bents,O., Lemcke,K.,
            Kolesov,G., Mayer,K., Rudd,S., Schoof,H., Schueller,C.,
            Zaccaria,P., Mewes,H.W., Bevan,M. and Fransz,P.
  CONSRTM   Kazusa DNA Research Institute; Cold Spring Harbor and Washington
            University in St Louis Sequencing Consortium; European Union
            Arabidopsis Genome Sequencing Consortium
  TITLE     Sequence and analysis of chromosome 5 of the plant Arabidopsis
            thaliana
  JOURNAL   Nature 408 (6814), 823-826 (2000)
   PUBMED   11130714
REFERENCE   2  (bases 1 to 429)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (19-OCT-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 429)
  AUTHORS   Krishnakumar,V., Cheng,C.-Y., Chan,A.P., Schobel,S., Kim,M.,
            Ferlanti,E.S., Belyaeva,I., Rosen,B.D., Micklem,G., Miller,J.R.,
            Vaughn,M. and Town,C.D.
  TITLE     Direct Submission
  JOURNAL   Submitted (17-MAY-2016) Plant Genomics, J. Craig Venter Institute,
            9704 Medical Center Dr, Rockville, MD 20850, USA
  REMARK    Protein update by submitter
REFERENCE   4  (bases 1 to 429)
  AUTHORS   Swarbreck,D., Lamesch,P., Wilks,C. and Huala,E.
  CONSRTM   TAIR
  TITLE     Direct Submission
  JOURNAL   Submitted (18-FEB-2011) Department of Plant Biology, Carnegie
            Institution, 260 Panama Street, Stanford, CA, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by TAIR and Araport.
            This record is derived from an annotated genomic sequence
            (NC_003076).
            
            On Sep 12, 2016 this sequence version replaced NM_120659.1.
            COMPLETENESS: incomplete on the 3' end.
FEATURES             Location/Qualifiers
     source          1..429
                     /organism="Arabidopsis thaliana"
                     /mol_type="mRNA"
                     /db_xref="taxon:3702"
                     /chromosome="5"
                     /ecotype="Columbia"
     gene            1..>429
                     /gene="WOX7"
                     /locus_tag="AT5G05770"
                     /gene_synonym="MJJ3.18; MJJ3_18; WOX5A; WUSCHEL related
                     homeobox 5A; WUSCHEL related homeobox 7"
                     /note="Encodes a WUSCHEL-related homeobox gene family
                     member with 65 amino acids in its homeodomain. Proteins in
                     this family contain a sequence of eight residues
                     (TLPLFPMH) downstream of the homeodomain called the WUS
                     box."
                     /db_xref="Araport:AT5G05770"
                     /db_xref="GeneID:830462"
                     /db_xref="TAIR:AT5G05770"
     CDS             61..429
                     /gene="WOX7"
                     /locus_tag="AT5G05770"
                     /gene_synonym="MJJ3.18; MJJ3_18; WOX5A; WUSCHEL related
                     homeobox 5A; WUSCHEL related homeobox 7"
                     /inference="Similar to RNA sequence,
                     EST:INSD:DR750916.1,INSD:DR751352.1,INSD:DR750917.1"
                     /note="WUSCHEL related homeobox 7 (WOX7); FUNCTIONS IN:
                     DNA binding, sequence-specific DNA binding transcription
                     factor activity; INVOLVED IN: regulation of transcription,
                     DNA-dependent; CONTAINS InterPro DOMAIN/s: Homeobox
                     (InterPro:IPR001356), Homeodomain-like
                     (InterPro:IPR009057); BEST Arabidopsis thaliana protein
                     match is: WUSCHEL related homeobox 5 (TAIR:AT3G11260.1);
                     Has 1807 Blast hits to 1807 proteins in 277 species:
                     Archae - 0; Bacteria - 0; Metazoa - 736; Fungi - 347;
                     Plants - 385; Viruses - 0; Other Eukaryotes - 339 (source:
                     NCBI BLink)."
                     /codon_start=1
                     /product="WUSCHEL related homeobox 7"
                     /protein_id="NP_196196.1"
                     /db_xref="GeneID:830462"
                     /db_xref="TAIR:AT5G05770"
                     /db_xref="Araport:AT5G05770"
                     /translation="
MSSRGFNIKARGLCNNNNGGGGTGAKCGRWNPTVEQVKLLTDLFKAGLRTPSTDQIQKISMELSFYGKIESKNVFYWFQNHKARERQKCRKISTVKFDHRQDTDLSKPRRDNVRRHQLPAKG"
     misc_feature    136..321
                     /gene="WOX7"
                     /locus_tag="AT5G05770"
                     /gene_synonym="MJJ3.18; MJJ3_18; WOX5A; WUSCHEL related
                     homeobox 5A; WUSCHEL related homeobox 7"
                     /note="Region: Homeodomain; pfam00046"
                     /db_xref="CDD:459649"
ORIGIN      
tataacatatccaaaaccctaaaacgcaaacactaagataactatttcttgaaattaataatgtcgtcgagaggattcaacattaaagctagaggattatgtaataacaacaacggaggaggaggaacgggggcgaagtgtggacggtggaatccaacggtggagcaagtgaagcttctgacagatctgttcaaggcgggactgcgaacaccgagcacggaccagattcagaagatctctatggagctgagtttctacggtaagattgagagcaagaacgtgttctattggttccaaaaccataaagctagagagagacaaaagtgccggaaaatctccaccgtcaagtttgatcatcgtcaagatacagatctttctaagcctcgccgagacaacgtacgtcgtcatcaactaccagcgaaaggttaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]