ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2024-11-15 19:06:38, GGRNA.v2 : RefSeq release 226 (Sep, 2024)
LOCUS NM_026509 4479 bp mRNA linear ROD 15-JUN-2024
DEFINITION Mus musculus caveolae associated 4 (Cavin4), mRNA.
ACCESSION NM_026509
VERSION NM_026509.4
KEYWORDS RefSeq; RefSeq Select.
SOURCE Mus musculus (house mouse)
ORGANISM Mus musculus
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE 1 (bases 1 to 4479)
AUTHORS Lo,H.P., Lim,Y.W., Xiong,Z., Martel,N., Ferguson,C., Ariotti,N.,
Giacomotto,J., Rae,J., Floetenmeyer,M., Moradi,S.V., Gao,Y.,
Tillu,V.A., Xia,D., Wang,H., Rahnama,S., Nixon,S.J., Bastiani,M.,
Day,R.D., Smith,K.A., Palpant,N.J., Johnston,W.A., Alexandrov,K.,
Collins,B.M., Hall,T.E. and Parton,R.G.
TITLE Cavin4 interacts with Bin1 to promote T-tubule formation and
stability in developing skeletal muscle
JOURNAL J Cell Biol 220 (12) (2021)
PUBMED 34633413
REMARK GeneRIF: Cavin4 interacts with Bin1 to promote T-tubule formation
and stability in developing skeletal muscle.
REFERENCE 2 (bases 1 to 4479)
AUTHORS Nishi,M., Ogata,T., Cannistraci,C.V., Ciucci,S., Nakanishi,N.,
Higuchi,Y., Sakamoto,A., Tsuji,Y., Mizushima,K. and Matoba,S.
TITLE Systems Network Genomic Analysis Reveals Cardioprotective Effect of
MURC/Cavin-4 Deletion Against Ischemia/Reperfusion Injury
JOURNAL J Am Heart Assoc 8 (15), e012047 (2019)
PUBMED 31364493
REMARK GeneRIF: Systems Network Genomic Analysis Reveals Cardioprotective
Effect of MURC/Cavin-4 Deletion Against Ischemia/Reperfusion
Injury.
REFERENCE 3 (bases 1 to 4479)
AUTHORS Miyagawa,K., Ogata,T., Ueyama,T., Kasahara,T., Nakanishi,N.,
Naito,D., Taniguchi,T., Hamaoka,T., Maruyama,N., Nishi,M.,
Kimura,T., Yamada,H., Aoki,H. and Matoba,S.
TITLE Loss of MURC/Cavin-4 induces JNK and MMP-9 activity enhancement in
vascular smooth muscle cells and exacerbates abdominal aortic
aneurysm
JOURNAL Biochem Biophys Res Commun 487 (3), 587-593 (2017)
PUBMED 28433630
REMARK GeneRIF: The MURC/Cavin-4 in vascular smooth muscle cells modulates
abdominal aortic aneurysm (AAA) progression at the early stage via
the activation of JNK and MMP-9. MURC/Cavin-4 is a potential
therapeutic target against AAA progression.
REFERENCE 4 (bases 1 to 4479)
AUTHORS Bang,M.L.
TITLE Animal Models of Congenital Cardiomyopathies Associated With
Mutations in Z-Line Proteins
JOURNAL J Cell Physiol 232 (1), 38-52 (2017)
PUBMED 27171814
REMARK Review article
REFERENCE 5 (bases 1 to 4479)
AUTHORS Nakanishi,N., Ogata,T., Naito,D., Miyagawa,K., Taniguchi,T.,
Hamaoka,T., Maruyama,N., Kasahara,T., Nishi,M., Matoba,S. and
Ueyama,T.
TITLE MURC deficiency in smooth muscle attenuates pulmonary hypertension
JOURNAL Nat Commun 7, 12417 (2016)
PUBMED 27546070
REMARK GeneRIF: MURC binds to Cav1 and inhibits the association of Cav1
with the active form of Galpha13, resulting in the facilitated
association of the active form of Galpha13 with p115RhoGEF. These
results reveal that MURC has a function in the development of
pulmonary hypertension through modulating Rho/ROCK signaling.
Publication Status: Online-Only
REFERENCE 6 (bases 1 to 4479)
AUTHORS Ogata,T., Naito,D., Nakanishi,N., Hayashi,Y.K., Taniguchi,T.,
Miyagawa,K., Hamaoka,T., Maruyama,N., Matoba,S., Ikeda,K.,
Yamada,H., Oh,H. and Ueyama,T.
TITLE MURC/Cavin-4 facilitates recruitment of ERK to caveolae and
concentric cardiac hypertrophy induced by alpha1-adrenergic
receptors
JOURNAL Proc Natl Acad Sci U S A 111 (10), 3811-3816 (2014)
PUBMED 24567387
REMARK GeneRIF: MURC/Cavin-4 facilitates recruitment of ERK to caveolae
and concentric cardiac hypertrophy induced by alpha1-adrenergic
receptors.
REFERENCE 7 (bases 1 to 4479)
AUTHORS Ludwig,A., Howard,G., Mendoza-Topaz,C., Deerinck,T., Mackey,M.,
Sandin,S., Ellisman,M.H. and Nichols,B.J.
TITLE Molecular composition and ultrastructure of the caveolar coat
complex
JOURNAL PLoS Biol 11 (8), e1001640 (2013)
PUBMED 24013648
REFERENCE 8 (bases 1 to 4479)
AUTHORS Bastiani,M., Liu,L., Hill,M.M., Jedrychowski,M.P., Nixon,S.J.,
Lo,H.P., Abankwa,D., Luetterforst,R., Fernandez-Rojo,M.,
Breen,M.R., Gygi,S.P., Vinten,J., Walser,P.J., North,K.N.,
Hancock,J.F., Pilch,P.F. and Parton,R.G.
TITLE MURC/Cavin-4 and cavin family members form tissue-specific caveolar
complexes
JOURNAL J Cell Biol 185 (7), 1259-1273 (2009)
PUBMED 19546242
REMARK GeneRIF: Data show that MURC/Cavin-4 forms a multiprotein complex
that associates with caveolae, and identify Cavin-4 as a novel
muscle disease candidate caveolar protein.
REFERENCE 9 (bases 1 to 4479)
AUTHORS Tagawa,M., Ueyama,T., Ogata,T., Takehara,N., Nakajima,N.,
Isodono,K., Asada,S., Takahashi,T., Matsubara,H. and Oh,H.
TITLE MURC, a muscle-restricted coiled-coil protein, is involved in the
regulation of skeletal myogenesis
JOURNAL Am J Physiol Cell Physiol 295 (2), C490-C498 (2008)
PUBMED 18508909
REMARK GeneRIF: findings suggest that MURC is involved in the skeletal
myogenesis that results from modulation of myogenin expression and
ERK activation; MURC may play pivotal roles in the molecular
mechanisms of skeletal myogenic differentiation
REFERENCE 10 (bases 1 to 4479)
AUTHORS Ogata,T., Ueyama,T., Isodono,K., Tagawa,M., Takehara,N.,
Kawashima,T., Harada,K., Takahashi,T., Shioi,T., Matsubara,H. and
Oh,H.
TITLE MURC, a muscle-restricted coiled-coil protein that modulates the
Rho/ROCK pathway, induces cardiac dysfunction and conduction
disturbance
JOURNAL Mol Cell Biol 28 (10), 3424-3436 (2008)
PUBMED 18332105
REMARK GeneRIF: MURC modulates RhoA signaling, and MURC plays an important
role in the development of cardiac dysfunction and conduction
disturbance with increased vulnerability to atrial arrhythmias.
COMMENT VALIDATED REFSEQ: This record has undergone validation or
preliminary review. The reference sequence was derived from
AL807771.6.
On Apr 2, 2024 this sequence version replaced NM_026509.3.
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: BC089601.1, AK009691.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
SAMN00849375, SAMN00849383
[ECO:0000348]
##Evidence-Data-END##
##RefSeq-Attributes-START##
RefSeq Select criteria :: based on single protein-coding transcript
##RefSeq-Attributes-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-476 AL807771.6 34882-35357
477-4479 AL807771.6 43293-47295
FEATURES Location/Qualifiers
source 1..4479
/organism="Mus musculus"
/mol_type="mRNA"
/strain="C57BL/6"
/db_xref="taxon:10090"
/chromosome="4"
/map="4 26.23 cM"
gene 1..4479
/gene="Cavin4"
/gene_synonym="2310039E09Rik; Murc"
/note="caveolae associated 4"
/db_xref="GeneID:68016"
/db_xref="MGI:MGI:1915266"
exon 1..476
/gene="Cavin4"
/gene_synonym="2310039E09Rik; Murc"
/inference="alignment:Splign:2.1.0"
misc_feature 54..56
/gene="Cavin4"
/gene_synonym="2310039E09Rik; Murc"
/note="upstream in-frame stop codon"
CDS 69..1157
/gene="Cavin4"
/gene_synonym="2310039E09Rik; Murc"
/note="muscle-restricted coiled-coil protein; cavin 4;
muscle-related coiled-coil protein"
/codon_start=1
/product="caveolae-associated protein 4"
/protein_id="NP_080785.2"
/db_xref="CCDS:CCDS18169.2"
/db_xref="GeneID:68016"
/db_xref="MGI:MGI:1915266"
/translation="
MEHNGSASNAGKIHQNRLSSVTEDEDQDAALTIVTVLDRVASVVDSVQASQKRIEERHREMGNAIKSVQIDLLKLSQSHSNTGYVVNKLFEKTRKVSAHIKDVKARVEKQQVRVTKVETKQEEIMKKNKFRVVIFQEDIPCPASLSVVKDRSLPENQEEAEEVFDPPIELSSDEEYYVEESRSARLRKSGKEHIDHIKKAFSRENMQKTRQTLDKKVSGIRTRIVTPERRERLRQSGERLRQSGERLRQSGERFKKSISSAAPSKEAFKIRSLRKAKDPKAEGQEVDRGMGVDIISGSLALGPIHEFHSDEFSETEKEVTKGGYSPQEGGDPPTPEPLKVTFKPQVRVEDDESLLLELKQSS"
misc_feature 69..140
/gene="Cavin4"
/gene_synonym="2310039E09Rik; Murc"
/note="propagated from UniProtKB/Swiss-Prot (A2AMM0.1);
Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
misc_feature 147..857
/gene="Cavin4"
/gene_synonym="2310039E09Rik; Murc"
/note="PTRF/SDPR family; Region: PTRF_SDPR; pfam15237"
/db_xref="CDD:464578"
misc_feature 522..524
/gene="Cavin4"
/gene_synonym="2310039E09Rik; Murc"
/note="Phosphoserine.
/evidence=ECO:0000250|UniProtKB:B1PRL5; propagated from
UniProtKB/Swiss-Prot (A2AMM0.1); phosphorylation site"
misc_feature 579..581
/gene="Cavin4"
/gene_synonym="2310039E09Rik; Murc"
/note="Phosphoserine.
/evidence=ECO:0000250|UniProtKB:B1PRL5; propagated from
UniProtKB/Swiss-Prot (A2AMM0.1); phosphorylation site"
misc_feature 582..584
/gene="Cavin4"
/gene_synonym="2310039E09Rik; Murc"
/note="Phosphoserine.
/evidence=ECO:0000250|UniProtKB:B1PRL5; propagated from
UniProtKB/Swiss-Prot (A2AMM0.1); phosphorylation site"
misc_feature 756..935
/gene="Cavin4"
/gene_synonym="2310039E09Rik; Murc"
/note="propagated from UniProtKB/Swiss-Prot (A2AMM0.1);
Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
misc_feature 981..1106
/gene="Cavin4"
/gene_synonym="2310039E09Rik; Murc"
/note="propagated from UniProtKB/Swiss-Prot (A2AMM0.1);
Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
misc_feature 1038..1040
/gene="Cavin4"
/gene_synonym="2310039E09Rik; Murc"
/note="Phosphotyrosine.
/evidence=ECO:0007744|PubMed:21183079; propagated from
UniProtKB/Swiss-Prot (A2AMM0.1); phosphorylation site"
misc_feature 1068..1070
/gene="Cavin4"
/gene_synonym="2310039E09Rik; Murc"
/note="Phosphothreonine.
/evidence=ECO:0007744|PubMed:21183079; propagated from
UniProtKB/Swiss-Prot (A2AMM0.1); phosphorylation site"
misc_feature 1125..1127
/gene="Cavin4"
/gene_synonym="2310039E09Rik; Murc"
/note="Phosphoserine.
/evidence=ECO:0007744|PubMed:21183079; propagated from
UniProtKB/Swiss-Prot (A2AMM0.1); phosphorylation site"
exon 477..4479
/gene="Cavin4"
/gene_synonym="2310039E09Rik; Murc"
/inference="alignment:Splign:2.1.0"
regulatory 1995..2000
/regulatory_class="polyA_signal_sequence"
/gene="Cavin4"
/gene_synonym="2310039E09Rik; Murc"
/note="hexamer: AATAAA"
polyA_site 2014
/gene="Cavin4"
/gene_synonym="2310039E09Rik; Murc"
/note="major polyA site"
regulatory 4446..4451
/regulatory_class="polyA_signal_sequence"
/gene="Cavin4"
/gene_synonym="2310039E09Rik; Murc"
/note="hexamer: AATAAA"
polyA_site 4479
/gene="Cavin4"
/gene_synonym="2310039E09Rik; Murc"
ORIGIN
gccgacttttggctccaggcgtaggaaccggattgccataggacaccttctgctgagaaaaaagtaaaatggaacacaacggatcagcttcaaatgctggtaaaatccaccagaatcggttgtcaagtgtgacggaagatgaagaccaagacgcagccctcaccattgtgaccgtgctggacagagtggccagtgtcgtggacagtgtgcaggcaagccagaagagaattgaggagagacacagagaaatgggtaacgcgataaagtctgtccaaatagacctgctgaagctctcacagtcacacagcaatacgggctacgttgtcaacaagctgtttgagaagacccggaaagtcagcgctcacattaaggatgtcaaggcccgggtagagaagcaacaggttcgtgtaaccaaagtcgaaaccaagcaagaagaaataatgaagaaaaacaaattccgagtggtaatcttccaggaggacattccctgccccgcatccctgtctgttgttaaagacagaagcctgcccgagaaccaggaggaggccgaagaagtcttcgatcccccaatagagctctcctcggatgaggagtattatgttgaagaaagcagatctgccaggcttaggaagtcaggcaaagagcacattgaccacatcaagaaagccttttccagagaaaacatgcagaagacacggcagactcttgacaagaaagtgagtgggattagaactaggatagtcactcctgagaggagagagaggctgaggcagtcgggagagaggctgaggcagtcaggagagaggctgaggcagtcgggggaaagatttaagaaatcgatttccagtgccgctccctcaaaggaagcttttaagattcggagccttaggaaagcgaaggatcccaaggccgagggccaggaggtagacagagggatgggcgtggacatcatctcaggtagcctggctctggggcccatccatgagttccactctgatgagttcagtgaaacagaaaaggaggtgaccaaaggagggtacagtccccaagaaggaggggaccccccaacgcctgagcctttgaaggtgacttttaaaccccaggtgagggtagaggatgacgagtcactcctgttggagctaaagcagtcctcatagaggatttaagtacgagcatccatcacttggaatcatgtggttgtagtttgaatggtgtggtattcatattcatttatattcatccgcagtggaaaggcagatggtagaaaagcttcatttcttacctctaaaatcctaaagatgctggaaatattatatacaatttttgtacaatttccttgggaattctattcccctgagaatatatgactctgacagcaccccacccctgtctgcctacccccttacgtcatgccttttcgtggcagctcttggccaatgagaaaatagttgcacggctctggtcagttagatgatatgccattcataacacaggaacaacggatctgtgtccgttgttcatcagcaaactctagatctgggtcaggattgacacatccagtcaagaaggggagtagctgatgagtacatcgtgttatccagatgttcacatctggagattcattagtgagtcagtagccttatgaaggttacaaagttcttgtgtgagggaaaggaaatggaagtctgggacttgaacattttagctgcggcaacataactttattctagtgagatacttggctggttgccacatattctcaatgctaaaatgaaaaaaagggcttgctcttcctgtacttcttggagaacttgagatctgaggtggtgtcacagagtttgtgagaacaagacacacgacaagtggagaagcccacaaatcgcactggctcccctaacacagaatggaaacagttacatctgtgaggaagccctcggcacaggctccaaggccagagctgagcggaaactggggtggttcacaagtcttcacggaataaagagtgaaaaaagaatgcttgcatgggtgccttctcgttacagactgagaccataccttggccttttagccacgtcctaacatactccttggaaatctgcctctaattgtctttagatttggacatggtgtgggcgagtgcaggtgttgtttgcacagcacaaggtagaagtatggggctcagttgtcaagtggcttttctggggtctgccctgatgtgctggacatgggaatgacttccggcatgcctgttttccagagtgagccctttagggctaagaacagcacccctaagctgtcacagccaccttggagggcgtccaattcctgttacctcttagatttacatctgggtggtcaagaagtagaaattgctactgaaggaaaaccatactgattccgcacttccagcacactgtagtcttcaggtcattttcttgatatggaaaagatggtaggattttatatatatatattttactcacatttagtttaatttggaatattcatgtagtacttaaataaatgcaggcatgacggtgcatgtctgctaccccagcactgagaaggctgaaacaggtcacaaatggagtgagcctggattctctttatatgtacagatcagtatagtttccttttcgcatggcctgaatacatgttcttcttgctgcctcctcttcctcctcctcctccctcctcctccctcctcctccttctcctcttcctactcttcctcttcttcctcctcctttctcctcctccttcctcctcctcctcctcctctcttttggtttgtttgtttgtttttgttttttttgagacagggtttctttgtgtggccttggatgtcctggaactttctctgtagaccaggctggcctctaactcacagacacctgcctgcgtctgcctcctgagtgctggggttaaaggcatgcatcaccactacacagcatcttgttctctttatactgcaaactaaagcattgagtaaaactttgaaagaataattccaaacacattttcataacagctgagaaggaggttaggtgtccaagaataaatttgaatgtgagatgatgttattgcaaaacgtgaggccagtattgtggttgtaaatcttttaaccaatgacgaatggtaaccacaatatgcaaatgaaggatgagttaaccgatggtaaatcaaggctccgagggaatatagggaagtcagagctgtggtaagtcgagggtaggaagaatatcgagaagttacagtagttgttttccgtttgtttcatttggtctaaaatatttttctgcaaatatctagggcttttgtttactgactcattaatatccagccttaacagcttttaaagtgttgcaccagcagctatgttagagtctgactgggaaggagctatgtcctggccagctccttgtcttgatagctagcatttggcaccagaaccaccggatgttttgtgctgctgacggctcactgtaatcctgtgctctgtgttcactaacaggagtccccctccatgttgtaagatcatgtgtcagcatcttttcatgtctaggacatccctaaattctacattaaggatctcttgtaccagtccctccaggggtgactgacattcagccggtggtttggggagatgtaccttccactttagaccatggccaagttcatccgtaacttcgcaaagaaggcaccatcgatgatggccgctaccgtgacttactcgaagccttgattggccacattttggcactatgccaaggttgaggttgttcccccaacccctggtgaaacccctatgtgaattcagagcatgaactaaattattcagctgggcgtggtggcgcatgcctttaaccccagcacttgggaggcagaggaaggtgaatttctgagtttgaggccagcctggtctacagagtgagttccaggacagctagggctacacagagaaaccctgtcaaaaaaacaaaacaaaacaaaacaaaaaatcaaagtgctaaaactggtaacttcaaacacttccgatttgtgctcttatttgaacattcttgtatcttctaccttctttcatggcgtggagatgatgggctgcaaaattcacacactcacttaacgtaaatgacattctaggcagtgttcattattttaaaacacccggttacttactgatcagtagtgcagtgttacacaccaggctttaaacaatttactcaagtcaaacccttcgagggacttacccccttctgggagtgagatggagcagggcagctgctgcagttgctaggtgaggagctggggtggaggctctgccaggggagacagggaaaggcaagcctgtctcctgcatgtgatgatccaggtatcggagtcaacacgggcgttcggcttgtcgagagtggatttgtgtgtattccccaaaacaagttttcatgaataaaaagtagaagccaaagtaaaaaaatccaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]