GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-11-15 18:23:03, GGRNA.v2 : RefSeq release 226 (Sep, 2024)

LOCUS       NM_001348833             579 bp    mRNA    linear   PLN 28-JUN-2024
DEFINITION  Saccharomyces cerevisiae S288C uncharacterized protein (YFR054C),
            partial mRNA.
ACCESSION   NM_001348833
VERSION     NM_001348833.1
DBLINK      BioProject: PRJNA128
KEYWORDS    RefSeq.
SOURCE      Saccharomyces cerevisiae S288C
  ORGANISM  Saccharomyces cerevisiae S288C
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
            Saccharomyces.
REFERENCE   1  (bases 1 to 579)
  AUTHORS   Engel,S.R., Wong,E.D., Nash,R.S., Aleksander,S., Alexander,M.,
            Douglass,E., Karra,K., Miyasato,S.R., Simison,M., Skrzypek,M.S.,
            Weng,S. and Cherry,J.M.
  TITLE     New data and collaborations at the Saccharomyces Genome Database:
            updated reference genome, alleles, and the Alliance of Genome
            Resources
  JOURNAL   Genetics 220 (4) (2022)
   PUBMED   34897464
REFERENCE   2  (bases 1 to 579)
  AUTHORS   Goffeau,A., Barrell,B.G., Bussey,H., Davis,R.W., Dujon,B.,
            Feldmann,H., Galibert,F., Hoheisel,J.D., Jacq,C., Johnston,M.,
            Louis,E.J., Mewes,H.W., Murakami,Y., Philippsen,P., Tettelin,H. and
            Oliver,S.G.
  TITLE     Life with 6000 genes
  JOURNAL   Science 274 (5287), 546 (1996)
   PUBMED   8849441
REFERENCE   3  (bases 1 to 579)
  AUTHORS   Murakami,Y., Naitou,M., Hagiwara,H., Shibata,T., Ozawa,M.,
            Sasanuma,S., Sasanuma,M., Tsuchiya,Y., Soeda,E., Yokoyama,K. et al.
  TITLE     Analysis of the nucleotide sequence of chromosome VI from
            Saccharomyces cerevisiae
  JOURNAL   Nat. Genet. 10 (3), 261-268 (1995)
   PUBMED   7670463
REFERENCE   4  (bases 1 to 579)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (28-JUN-2024) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   5  (bases 1 to 579)
  CONSRTM   Saccharomyces Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2015) Department of Genetics, Stanford
            University, Stanford, CA 94305-5120, USA
  REMARK    Protein update by submitter
REFERENCE   6  (bases 1 to 579)
  CONSRTM   Saccharomyces Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (04-MAY-2012) Department of Genetics, Stanford
            University, Stanford, CA 94305-5120, USA
  REMARK    Protein update by submitter
REFERENCE   7  (bases 1 to 579)
  CONSRTM   Saccharomyces Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (31-MAR-2011) Department of Genetics, Stanford
            University, Stanford, CA 94305-5120, USA
  REMARK    Sequence update by submitter
REFERENCE   8  (bases 1 to 579)
  CONSRTM   Saccharomyces Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (11-DEC-2009) Department of Genetics, Stanford
            University, Stanford, CA 94305-5120, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by SGD. This record
            is derived from an annotated genomic sequence (NC_001138).
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: SGD
            Annotation Status   :: Full Annotation
            Annotation Version  :: R64-5-1
            URL                 :: http://www.yeastgenome.org/
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..579
                     /organism="Saccharomyces cerevisiae S288C"
                     /mol_type="mRNA"
                     /strain="S288C"
                     /db_xref="taxon:559292"
                     /chromosome="VI"
     gene            <1..>579
                     /locus_tag="YFR054C"
                     /db_xref="GeneID:850615"
     CDS             1..579
                     /locus_tag="YFR054C"
                     /note="hypothetical protein; conserved among S. cerevisiae
                     strains"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="NP_001335774.1"
                     /db_xref="GeneID:850615"
                     /db_xref="SGD:S000001950"
                     /translation="
MLFAYSGCLAPQCIPDISSFKALPFRDTESRFTTDSSVISSRFSSSFTSSSSKIIIITSIFSSKMDNEHVGASLIVSLSMASLILTNVFSFSSTSYSSQPSDYIACSPSGIDDQPVAEPSGYTPVGSSSPHSGCITSGLDAIGYQSSLNEGQSTNASSRFVTKVYSHSALTHIILHLLSILQKFYLQVSTIS"
ORIGIN      
atgctctttgcatattcaggttgccttgcccctcaatgcatacctgatattagtagtttcaaggcgcttccattccgtgacactgagagtcggtttactaccgactcttccgtaatctcgagccgtttttcaagtagctttacgagtagttcgagcaaaattattattatcacttctattttttcctcaaaaatggataacgaacatgtaggtgcctctctaattgtttctttgagcatggctagtctaatcttaactaatgtgttcagttttagctctactagctattcctcgcaaccatctgattatattgcatgctcccccagtggtattgatgaccaacctgtggctgaaccttctggatacacacctgttggctcctcatctccacattctggttgtattacttctggtttggatgcaataggttaccaatcttcacttaatgaaggccaatcgacgaatgcatcttccagattcgtcacaaaagtttacagtcattctgccttaactcatataattttacatttactcagtatccttcagaagttttacctacaagtaagcaccatttcttaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]