GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-04-20 14:20:43, GGRNA.v2 : RefSeq release 229 (Mar, 2025)

LOCUS       NM_001111641            1227 bp    mRNA    linear   PLN 03-APR-2024
DEFINITION  Zea mays Glutathione transferase III(b) (LOC541990), mRNA.
ACCESSION   NM_001111641
VERSION     NM_001111641.2
KEYWORDS    RefSeq.
SOURCE      Zea mays
  ORGANISM  Zea mays
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; Liliopsida; Poales; Poaceae; PACMAD
            clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae;
            Zea.
REFERENCE   1  (bases 1 to 1227)
  AUTHORS   Jia,J., Fu,J., Zheng,J., Zhou,X., Huai,J., Wang,J., Wang,M.,
            Zhang,Y., Chen,X., Zhang,J., Zhao,J., Su,Z., Lv,Y. and Wang,G.
  TITLE     Annotation and expression profile analysis of 2073 full-length
            cDNAs from stress-induced maize (Zea mays L.) seedlings
  JOURNAL   Plant J 48 (5), 710-727 (2006)
   PUBMED   17076806
REFERENCE   2  (bases 1 to 1227)
  AUTHORS   McGonigle,B., Keeler,S.J., Lau,S.M., Koeppe,M.K. and O'Keefe,D.P.
  TITLE     A genomics approach to the comprehensive analysis of the
            glutathione S-transferase gene family in soybean and maize
  JOURNAL   Plant Physiol 124 (3), 1105-1120 (2000)
   PUBMED   11080288
REFERENCE   3  (bases 1 to 1227)
  AUTHORS   Dixon,D.P., Cole,D.J. and Edwards,R.
  TITLE     Dimerisation of maize glutathione transferases in recombinant
            bacteria
  JOURNAL   Plant Mol Biol 40 (6), 997-1008 (1999)
   PUBMED   10527424
REFERENCE   4  (bases 1 to 1227)
  AUTHORS   Touzet,P., Riccardi,F., Morin,C., Damerval,C., Huet,J.C.,
            Pernollet,J.C., Zivy,M. and de Vienne,D.
  TITLE     The maize two-dimensional gel protein database: towards an
            integrated genome analysis program
  JOURNAL   Theor Appl Genet 93 (5-6), 997-1005 (1996)
   PUBMED   24162436
REFERENCE   5  (bases 1 to 1227)
  AUTHORS   Grove,G., Zarlengo,R.P., Timmerman,K.P., Li,N.Q., Tam,M.F. and
            Tu,C.P.
  TITLE     Characterization and heterospecific expression of cDNA clones of
            genes in the maize GSH S-transferase multigene family
  JOURNAL   Nucleic Acids Res 16 (2), 425-438 (1988)
   PUBMED   3277162
REFERENCE   6  (bases 1 to 1227)
  AUTHORS   Moore,R.E., Davies,M.S., O'Connell,K.M., Harding,E.I., Wiegand,R.C.
            and Tiemeier,D.C.
  TITLE     Cloning and expression of a cDNA encoding a maize
            glutathione-S-transferase in E. coli
  JOURNAL   Nucleic Acids Res 14 (18), 7227-7235 (1986)
   PUBMED   3532034
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            BT062456.1 and BT037522.1.
            
            On Oct 10, 2015 this sequence version replaced NM_001111641.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BT037522.1, BT041458.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN00780084, SAMN00780085
                                           [ECO:0000348]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-969               BT062456.1         1-969
            970-1227            BT037522.1         908-1165
FEATURES             Location/Qualifiers
     source          1..1227
                     /organism="Zea mays"
                     /mol_type="mRNA"
                     /db_xref="taxon:4577"
                     /chromosome="3"
                     /map="3"
     gene            1..1227
                     /gene="LOC541990"
                     /gene_synonym="GRMZM2G146246; GST3; gst3a; gst3b; gst4"
                     /note="Glutathione transferase III(b)"
                     /db_xref="GeneID:541990"
     exon            1..284
                     /gene="LOC541990"
                     /gene_synonym="GRMZM2G146246; GST3; gst3a; gst3b; gst4"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    27..29
                     /gene="LOC541990"
                     /gene_synonym="GRMZM2G146246; GST3; gst3a; gst3b; gst4"
                     /note="upstream in-frame stop codon"
     CDS             135..800
                     /gene="LOC541990"
                     /gene_synonym="GRMZM2G146246; GST3; gst3a; gst3b; gst4"
                     /EC_number="2.5.1.18"
                     /note="GSTIII; phi073; Gst-III; GST class-phi member 3;
                     glutathione S-transferase4; Glutathione transferase
                     III(a); glutathione S-transferase III"
                     /codon_start=1
                     /product="glutathione S-transferase 3"
                     /protein_id="NP_001105111.2"
                     /db_xref="GeneID:541990"
                     /translation="
MAPLKLYGMPLSPNVVRVATVLNEKGLDFEIVPVDLTTGAHKQPDFLALNPFGQIPALVDGDEVLFESRAINRYIASKYASEGTDLLPATASAAKLEVWLEVESHHFYPNASPLVFQLLVRPLLGGAPDAAVVDKHAEQLAKVLDVYEAHLARNKYLAGDEFTLADANHASYLLYLSKTPKAGLVAARPHVKAWWEAIVARPAFQKTVAAIPLPPPPSSSA"
     misc_feature    144..761
                     /gene="LOC541990"
                     /gene_synonym="GRMZM2G146246; GST3; gst3a; gst3b; gst4"
                     /note="glutathione S-transferase; Region: PLN02395"
                     /db_xref="CDD:166036"
     exon            285..333
                     /gene="LOC541990"
                     /gene_synonym="GRMZM2G146246; GST3; gst3a; gst3b; gst4"
                     /inference="alignment:Splign:2.1.0"
     exon            334..1227
                     /gene="LOC541990"
                     /gene_synonym="GRMZM2G146246; GST3; gst3a; gst3b; gst4"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
ccttcgtcagctggcagctgctataataaggaaggaagaagataacggagggcaaggaaactcgctcccactctactcctatccactgcggcctggacgcgtgcgagagacttgaccaagcagcagcagcagggatggcgcctctgaagctgtacgggatgccgctgtcccccaacgtggtgcgcgtggccaccgtgctcaacgagaagggcctcgacttcgagatcgtccccgtcgacctcaccaccggcgcccacaagcagcccgacttcctcgccctcaaccctttcggccagatcccggctctcgtcgacggagacgaagtcctcttcgagtcccgtgcgatcaaccggtacatcgccagcaagtacgcgtcggagggcacggacctgctccccgcgacggcgtcggcggcgaagctggaggtgtggctagaggtggagtcgcaccacttctacccgaacgcgtcgccgctggtgttccagctgctcgtgaggccgctcctgggcggcgcccccgacgcggcggtggtggacaagcacgcggagcagctcgccaaggtgctcgacgtgtacgaggcgcacctcgcccgcaacaagtacctcgccggggacgagttcacgctcgccgacgccaaccacgcgtcctacctgctctacctcagcaagacccccaaggccgggctcgtcgccgcccgcccccacgtcaaggcctggtgggaggccatcgtcgcccgccccgcgttccagaagaccgtcgccgccatccccttgcccccgccgccctcctcctcggcttgacctcgccttgcgttgcgccgttgcctgggtcgcggatgcgtcggagccccgagtcgaataaaagaggcagcatcctgtcttgcatttgctgctgcgccatgtgttaacagcctgtgtaataaacactgttgctttcgtgtgtgttcattgccttttggttggtctttgcatatcctactagtgctgatctttttgtgaagcttggattggatggacgcgttttcttcaccgtaattcccttcttcctgagcgacgtgactgttgattcgaacaacaacaaaattttcggcccacaaccgcaaggcccgttcctacgactcacctgttgggtttgggttacagttaaggccttcctcttggatgaatttatatcccatatctaattctatggtgggattaaatccatcatttaattcatgtatctctc
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]