LOCUS       NM_001012022            1824 bp    mRNA    linear   ROD 04-DEC-2023
DEFINITION  Rattus norvegicus claudin 4 (Cldn4), mRNA.
ACCESSION   NM_001012022 XM_222090
VERSION     NM_001012022.1
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 1824)
  AUTHORS   Ren Q, Xu Y, Xu L, Lu Y and Zheng Y.
  TITLE     Hypoxic bone marrow mesenchymal stem cell-derived exosomal lncRNA
            XIST attenuates lipopolysaccharide-induced acute lung injury via
            the miR-455-3p/Claudin-4 axis
  JOURNAL   Int Immunopharmacol 125 (Pt A), 111066 (2023)
   PUBMED   37866316
  REMARK    GeneRIF: Hypoxic bone marrow mesenchymal stem cell-derived exosomal
            lncRNA XIST attenuates lipopolysaccharide-induced acute lung injury
            via the miR-455-3p/Claudin-4 axis.
REFERENCE   2  (bases 1 to 1824)
  AUTHORS   Xu X, Zhang X, Gao L, Liu C and You K.
  TITLE     Neonatal Hyperoxia Downregulates Claudin-4, Occludin, and ZO-1
            Expression in Rat Kidney Accompanied by Impaired Proximal Tubular
            Development
  JOURNAL   Oxid Med Cell Longev 2020, 2641461 (2020)
   PUBMED   33343804
  REMARK    GeneRIF: Neonatal Hyperoxia Downregulates Claudin-4, Occludin, and
            ZO-1 Expression in Rat Kidney Accompanied by Impaired Proximal
            Tubular Development.
            Publication Status: Online-Only
REFERENCE   3  (bases 1 to 1824)
  AUTHORS   Berndt P, Winkler L, Cording J, Breitkreuz-Korff O, Rex A, Dithmer
            S, Rausch V, Blasig R, Richter M, Sporbert A, Wolburg H, Blasig IE
            and Haseloff RF.
  TITLE     Tight junction proteins at the blood-brain barrier: far more than
            claudin-5
  JOURNAL   Cell Mol Life Sci 76 (10), 1987-2002 (2019)
   PUBMED   30734065
REFERENCE   4  (bases 1 to 1824)
  AUTHORS   Molina-Jijon E, Rodriguez-Munoz R, Gonzalez-Ramirez R,
            Namorado-Tonix C, Pedraza-Chaverri J and Reyes JL.
  TITLE     Aldosterone signaling regulates the over-expression of claudin-4
            and -8 at the distal nephron from type 1 diabetic rats
  JOURNAL   PLoS One 12 (5), e0177362 (2017)
   PUBMED   28493961
  REMARK    GeneRIF: the participation of aldosterone (ALD), and the effect of
            spironolactone (SPL), a mineralocorticoid receptor antagonist, on
            the expressions of claudin-2, -4, -5 and -8, and occludin in
            glomeruli, proximal and distal tubules isolated from diabetic rats,
            was evaluated.
            Publication Status: Online-Only
REFERENCE   5  (bases 1 to 1824)
  AUTHORS   Jo CH, Kim S, Oh IH, Park JS and Kim GH.
  TITLE     Alteration of Tight Junction Protein Expression in Dahl
            Salt-Sensitive Rat Kidney
  JOURNAL   Kidney Blood Press Res 42 (6), 951-960 (2017)
   PUBMED   29179201
  REMARK    GeneRIF: Both upregulation of claudin-4 and downregulation of
            occludin might increase paracellular NaCl transport in the kidney,
            resulting in impaired pressure natriuresis in SS rats.
REFERENCE   6  (bases 1 to 1824)
  AUTHORS   Kondoh M, Masuyama A, Takahashi A, Asano N, Mizuguchi H, Koizumi N,
            Fujii M, Hayakawa T, Horiguchi Y and Watanbe Y.
  TITLE     A novel strategy for the enhancement of drug absorption using a
            claudin modulator
  JOURNAL   Mol Pharmacol 67 (3), 749-756 (2005)
   PUBMED   15602007
  REMARK    GeneRIF: Clostridium enterotoxin enhances the absorption of dextran
            in rat jejunum, apparently through interactions with claudin-4.
REFERENCE   7  (bases 1 to 1824)
  AUTHORS   Tsukahara M, Nagai H, Kamiakito T, Kawata H, Takayashiki N, Saito K
            and Tanaka A.
  TITLE     Distinct expression patterns of claudin-1 and claudin-4 in
            intraductal papillary-mucinous tumors of the pancreas
  JOURNAL   Pathol Int 55 (2), 63-69 (2005)
   PUBMED   15693851
REFERENCE   8  (bases 1 to 1824)
  AUTHORS   Peppi M and Ghabriel MN.
  TITLE     Tissue-specific expression of the tight junction proteins claudins
            and occludin in the rat salivary glands
  JOURNAL   J Anat 205 (4), 257-266 (2004)
   PUBMED   15447685
REFERENCE   9  (bases 1 to 1824)
  AUTHORS   Acharya P, Beckel J, Ruiz WG, Wang E, Rojas R, Birder L and Apodaca
            G.
  TITLE     Distribution of the tight junction proteins ZO-1, occludin, and
            claudin-4, -8, and -12 in bladder epithelium
  JOURNAL   Am J Physiol Renal Physiol 287 (2), F305-F318 (2004)
   PUBMED   15068973
REFERENCE   10 (bases 1 to 1824)
  AUTHORS   Morita K, Furuse M, Fujimoto K and Tsukita S.
  TITLE     Claudin multigene family encoding four-transmembrane domain protein
            components of tight junction strands
  JOURNAL   Proc Natl Acad Sci U S A 96 (2), 511-516 (1999)
   PUBMED   9892664
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from BC083582.1.
            
            On Feb 11, 2005 this sequence version replaced XM_222090.1.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript is intronless :: BC083582.1, DN932106.1 [ECO:0000345]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..1824
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /db_xref="taxon:10116"
                     /chromosome="12"
                     /map="12q12"
     gene            1..1824
                     /gene="Cldn4"
                     /note="claudin 4"
                     /db_xref="GeneID:304407"
                     /db_xref="RGD:1307932"
     exon            1..1799
                     /gene="Cldn4"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    186..188
                     /gene="Cldn4"
                     /note="upstream in-frame stop codon"
     CDS             192..824
                     /gene="Cldn4"
                     /codon_start=1
                     /product="claudin-4"
                     /protein_id="NP_001012022.1"
                     /db_xref="GeneID:304407"
                     /db_xref="RGD:1307932"
                     /translation="

MASMGLQVLGISLAVLGWLGVILSCSLPMWRVTAFIGSNIVTAQTSWEGLWMNCVVQSTGQMQCKMYDSMLALPQDLQAARALMVISIIVGALGMLLSVVGGKCTNCMEDETVKAKVMITAGAVFIVASMLIMVPVSWTAHNVIRDFYNPLVASGQKREMGASLYIGWAASGLLLLGGGLLCCNCPPRRNEKPYSAKYSAARSVPASNYV"

     misc_feature    201..701
                     /gene="Cldn4"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; cl21598"
                     /db_xref="CDD:473919"
ORIGIN      

ccgctcccaattgcaggtgcgggctggaaagagctgcagtgttcgcgcttggtagctggtggaccgggctcagcaccttcggctggctttgtgtcccagaggctcaccggaaaaagactttctcagccctcggactccagagagagatacttttcgtgctccccaaccttgactcctgcagaagctgagcgatggcgtccatggggctgcaggtgctgggaatctccttggccgtcctgggctggttaggagtcatcctgagttgttcgctccccatgtggcgggtgaccgccttcatcggcagcaacatcgtcacggcgcagacgagctgggaaggcctgtggatgaactgcgtggtgcagagcaccggccagatgcagtgcaagatgtacgactcgatgctggccctgccgcaggacctgcaggccgcccgagccctgatggtcatcagcatcatcgtgggtgctctggggatgcttctctcagtcgtagggggcaagtgcaccaactgcatggaggacgagaccgtcaaggccaaggtcatgatcacagccggagccgtgttcatcgtggcaagcatgctgattatggtgcctgtgtcctggacggcacacaacgtcatccgcgacttctacaaccctctggtggcttccgggcagaaaagggagatgggggcctcgctttacatcggctgggcggcttctgggctgctgctcctgggaggaggcctcctctgctgcaattgcccacctcgccgcaacgaaaagccctactccgccaagtactccgccgcccgctctgttcccgccagcaactatgtgtaaggtgggccactctctgtccacattgcctttattttcttggattgaactcataacggcctgtggcccctcacattctccaggacctgaccagctgtgggctactgactgcttgcaaacccggactgtgctaagttactagcgtgtagcccttggggacccacctggcccatctggacacatctcaaggctccagcgaggatagatgtaaaaatatttccttgcttgcatccagattgctcatggatacggggctgaaggcagaagcagctgtctgggtacgacagtggagggggagctgggtcctgctggccgggatagctcagctgtgactttggtctctggagtggatgtcctggtcatgttagcaaacattcactgccctttctcagtgccctcgctctctcgcctccacgttactcccgcgctactcttgccgtttctcgcccgcgtttctgagcacaccaggtcctgcctggagtcttggtgtcgaggatgactgactgaaggggcctttgagagctgatgggttctgccatggactcctcccggtgattagcaatgactggggccttacccacccacctaccctcgtaatgaagttctgtggagtggctggacaggtttgagggaagggtggaggtggtttaaactggtttggggagtgctagggctggggacccagaagcagcccagggtgtccccacccctttcccatacggtcttgctaaatgttctgatctctgtataccccctccctcttcagaaggaccctgggtgggcccctctgaattccctacccttgtccatttcaaggacgctggccagtctgtggaaggtacgggggtctgatggcattgcaccagggagcctcctggactcccttgccttctctgtggtttcttgttttgtaatttaaggtctgttcacagctgtaattattattttctacaataaatggcacctgcatacaggaaaaaaaaaaaaaaaaaaaaaaaaaaaa

//