LOCUS       XM_012958526             670 bp    mRNA    linear   VRT 18-DEC-2019
DEFINITION  PREDICTED: Xenopus tropicalis myosin light chain 7 (myl7),
            transcript variant X1, mRNA.
ACCESSION   XM_012958526
VERSION     XM_012958526.2
DBLINK      BioProject: PRJNA205740
KEYWORDS    RefSeq.
SOURCE      Xenopus tropicalis (tropical clawed frog)
  ORGANISM  Xenopus tropicalis
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Amphibia; Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae;
            Xenopus; Silurana.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_030679.2) annotated using gene prediction method: Gnomon,
            supported by EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 18, 2019 this sequence version replaced XM_012958526.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Xenopus tropicalis Annotation
                                           Release 104
            Annotation Version          :: 104
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.3
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..670
                     /organism="Xenopus tropicalis"
                     /mol_type="mRNA"
                     /strain="Nigerian"
                     /db_xref="taxon:8364"
                     /chromosome="3"
                     /sex="female"
                     /tissue_type="liver and blood"
                     /dev_stage="adult"
                     /note="F17 inbred"
     gene            1..670
                     /gene="myl7"
                     /gene_synonym="mlc2; myl2a; mylc2a"
                     /note="myosin light chain 7; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 197
                     ESTs, 18 Proteins, and 100% coverage of the annotated
                     genomic feature by RNAseq alignments, including 46 samples
                     with support for all annotated introns"
                     /db_xref="GeneID:100135145"
                     /db_xref="Xenbase:XB-GENE-964041"
     CDS             102..623
                     /gene="myl7"
                     /gene_synonym="mlc2; myl2a; mylc2a"
                     /codon_start=1
                     /product="myosin regulatory light chain 2, atrial isoform
                     isoform X1"
                     /protein_id="XP_012813980.1"
                     /db_xref="GeneID:100135145"
                     /db_xref="Xenbase:XB-GENE-964041"
                     /translation="

MASRKAAGKAAAKRAQRGSSNVFSMFEQSQIQEFKEAFSCIDQNRDGIITKSDLKETYMQLGKMNVNEDELDEMLKEGKGPINFTVFLSLFGEKLNGTDPEDSILAAFKILDPNATGNINKDELKQLLMTQADKFTAEEVDQMFAVTPIDVAGNIDYKSLCYIITHGDEKEDS"

     misc_feature    174..596
                     /gene="myl7"
                     /gene_synonym="mlc2; myl2a; mylc2a"
                     /note="calmodulin; Provisional; Region: PTZ00184"
                     /db_xref="CDD:185504"
ORIGIN      

gcctggagctattttagctatggttgagataagaagtagtataaaatggcaaggagaactttccattaggtggcacaggacaaaggaagaaagcaaagaacatggccagcagaaaagctgcagggaaggcagctgctaaacgtgctcagcgaggctcctccaatgtcttctccatgtttgagcagtcacagatccaagaatttaaggaggcatttagctgtattgaccaaaaccgtgatgggatcatcaccaaatctgacctcaaagaaacatatatgcaattggggaagatgaatgtgaacgaggatgagctggacgagatgctcaaagagggcaagggacccattaacttcacagtgttcctgtcactgtttggcgagaagcttaacggaacggacccagaagactcaatccttgctgcatttaaaattctcgaccccaatgcaactggcaatatcaacaaagatgaattaaagcaacttctgatgacacaagcagacaaattcactgcagaggaggtagaccagatgttcgccgtgactccgattgacgtagcaggaaatattgactacaagtcactgtgttatatcatcacgcatggagatgaaaaagaagactcataaacattcagctggaaataaaatcacaagttctgcagtctgttatttca

//