GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-04-17 04:24:42, GGRNA.v2 : RefSeq release 229 (Mar, 2025)

LOCUS       XM_012957615            1009 bp    mRNA    linear   VRT 18-DEC-2019
DEFINITION  PREDICTED: Xenopus tropicalis claudin 34 (cldn34), transcript
            variant X2, mRNA.
ACCESSION   XM_012957615
VERSION     XM_012957615.3
DBLINK      BioProject: PRJNA205740
KEYWORDS    RefSeq.
SOURCE      Xenopus tropicalis (tropical clawed frog)
  ORGANISM  Xenopus tropicalis
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Amphibia; Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae;
            Xenopus; Silurana.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_030678.2) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 18, 2019 this sequence version replaced XM_012957615.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Xenopus tropicalis Annotation
                                           Release 104
            Annotation Version          :: 104
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.3
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1009
                     /organism="Xenopus tropicalis"
                     /mol_type="mRNA"
                     /strain="Nigerian"
                     /db_xref="taxon:8364"
                     /chromosome="2"
                     /sex="female"
                     /tissue_type="liver and blood"
                     /dev_stage="adult"
                     /note="F17 inbred"
     gene            1..1009
                     /gene="cldn34"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 1 Protein, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 14 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:101732192"
                     /db_xref="Xenbase:XB-GENE-6462643"
     CDS             190..984
                     /gene="cldn34"
                     /codon_start=1
                     /product="claudin-34"
                     /protein_id="XP_012813069.1"
                     /db_xref="GeneID:101732192"
                     /db_xref="Xenbase:XB-GENE-6462643"
                     /translation="
MPYLAHTANLQLAGFAFATVGWILGTITTGLVQWRVWYVSNTTIISSGIAWIGIWRTCFFSDVLVSSNQRVMYCQEFNVQDSFVPREIFVAQGLMIVAIILGAAGKAFSAFGLKNVYQGTPNVTVIPRRFIAAGVLTMLSSVFIIIPVAWNLHSVVNNFSIYFPSSYDMPSSPEKQEVGAAIAVGIVSSIFLFFSGTFFLSYKLPYNVDPRVFPLSSDDILCDGLSFATSITPRTNSIASRRSSNQILNCDGIPNEAFELDEKL"
     misc_feature    217..786
                     /gene="cldn34"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; cl21598"
                     /db_xref="CDD:473919"
ORIGIN      
acctgtacttcctggatgtgccttgcacggccctcgctacaatcactgggatcccatatcttagccactcactgtacagatctttccataataacatgtgagcaacaggatccagacctggtcagctgataatcaatgatcaggtgatgtgggggaaattttgacacagccactgaagaactccaggtcatgccctaccttgcccatactgcaaatcttcaacttgccgggtttgcatttgctactgttggctggattttgggcacaatcactacaggacttgtacaatggagagtttggtatgtgtctaataccaccatcatttcttctggcattgcttggataggcatctggcgaacttgtttcttcagtgatgtactagtgtcttccaaccaaagggtaatgtactgccaggaattcaatgttcaggattcctttgtacctcgggagatcttcgttgcacaaggactcatgatagtagctattatcctgggggcagcaggaaaagcatttagtgccttcggacttaagaatgtttatcaaggtacacctaatgtaactgtgatcccacggcggtttattgctgcaggagtgctcactatgctgtctagtgtgtttattataattccagtggcatggaacctacattctgttgtaaacaacttcagcatatactttccaagttcctatgatatgccatccagcccagagaagcaggaagttggtgctgctattgctgttggaattgtgtcttctattttcctgttctttagtgggacttttttcctttcttacaaactgccttacaatgtggatccaagggtctttccactgtcttcagatgatatactttgtgatggtctaagttttgccactagtataacacctaggactaacagcattgcatccagaagaagttcaaatcaaatactaaattgtgatggaattcctaatgaggcttttgaactagatgaaaagttgtaaataaatatatagtttttttctttga
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]