2025-04-17 04:58:31, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS XM_004912119 1433 bp mRNA linear VRT 18-DEC-2019 DEFINITION PREDICTED: Xenopus tropicalis claudin 14 (cldn14), mRNA. ACCESSION XM_004912119 VERSION XM_004912119.2 DBLINK BioProject: PRJNA205740 KEYWORDS RefSeq. SOURCE Xenopus tropicalis (tropical clawed frog) ORGANISM Xenopus tropicalis Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Amphibia; Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae; Xenopus; Silurana. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_030678.2) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 18, 2019 this sequence version replaced XM_004912119.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Xenopus tropicalis Annotation Release 104 Annotation Version :: 104 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.3 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1433 /organism="Xenopus tropicalis" /mol_type="mRNA" /strain="Nigerian" /db_xref="taxon:8364" /chromosome="2" /sex="female" /tissue_type="liver and blood" /dev_stage="adult" /note="F17 inbred" gene 1..1433 /gene="cldn14" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments" /db_xref="GeneID:100491910" /db_xref="Xenbase:XB-GENE-995700" CDS 109..819 /gene="cldn14" /codon_start=1 /product="claudin-14" /protein_id="XP_004912176.1" /db_xref="GeneID:100491910" /db_xref="Xenbase:XB-GENE-995700" /translation="
MASMALQLLGFSVALIGFIGTIVATVLPHWWRTAHVGTNIITAVAYMKGLWMECVWHSTGIYQCQVHQSQLALPRDLQVARAMMVASCVLSVLASVVSVFGMKCTQCAKGSSSKRMIAAFGGTFFALAGLMCLIPVAWSTNDVVQDFYNPGLPYGMKYEIGQALYVGFISGGLSVIGGIMILSTSCQRDNTPLPYTPQRRYPRKAPTSRSQPVNKSNHVPSWSSASRHGYHLNDFV"
misc_feature 118..648 /gene="cldn14" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:473919" ORIGIN
ttccaataatatttaacttcctactaagcttgttcattagcgcaggagagagatgagaagccggcacaaggagctgggagaagtctgggcagccatacagcagcacaaatggcaagcatggctctgcagctcctggggttctctgtggccctcattggcttcatcgggaccattgttgccacggtgctgccacactggtggaggacggctcatgttggcaccaatatcatcacggctgtggcatacatgaagggcctgtggatggagtgtgtgtggcacagtactggtatataccaatgccaagttcaccagtcccagctggcactcccaagagaccttcaggtagctcgggccatgatggttgcctcttgtgtcctgtcagttctggcttctgttgtgtcagtctttggcatgaagtgcacccagtgtgccaagggatcctcatccaagaggatgatagctgcttttggggggaccttctttgccctggccggccttatgtgcttgattccagttgcgtggtctactaacgatgtggttcaagacttttacaacccaggactgccttatgggatgaagtacgagattggacaggctctgtatgttggcttcatctcaggggggctatcggtgatcgggggtatcatgatactttccacatcatgtcaaagggacaacactcctctaccctacactcctcaaagacgctaccccagaaaggctccaaccagcagatctcagcccgtcaacaaaagcaaccatgtaccatcatggtcttctgcttctcgccatggctaccaccttaatgactttgtatgagagcacctctataagcagggacttgtttaagaattccatgggatttccccatacttccatgagaaattacttatgtcaatgttttcttcctattaatgtttactttgcagaaggaactgaaacccagatgtgcatttggggcaatagactataccatgccagtgggaagagtattattgcctaccatctgtcattgtctaccatctgtcattgtctatcatcattcaatgcccagtctttttaactgtgaaatagtattaatatccatcactgctatttgattgggtgttatatgtgtttaattgcggcttcaaagggcccaacatggaacggagaacccgcccaaccttcccccatccctatgtacagtaaagtggatcctagattattaaatctcagcctgtgagtatgggcagcaagggtgtataaacttcagttgttgttgtttttgtaactgaagggggcaataatgtgatattttgtacagggggcaatttaccccaaataaaaaaaaaatagtcttgtatatacagtaaatgtaaatgtaaaatataccagatcaaatgtaatggatagagaagcaagaaataaaagaaagatgggttattaagaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]