GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-04-17 05:13:19, GGRNA.v2 : RefSeq release 229 (Mar, 2025)

LOCUS       NM_203595                924 bp    mRNA    linear   VRT 22-DEC-2019
DEFINITION  Xenopus tropicalis B-cell translocation gene 1, anti-proliferative
            (btg1), mRNA.
ACCESSION   NM_203595
VERSION     NM_203595.1
KEYWORDS    RefSeq.
SOURCE      Xenopus tropicalis (tropical clawed frog)
  ORGANISM  Xenopus tropicalis
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Amphibia; Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae;
            Xenopus; Silurana.
REFERENCE   1  (bases 1 to 924)
  AUTHORS   Klein SL, Strausberg RL, Wagner L, Pontius J, Clifton SW and
            Richardson P.
  TITLE     Genetic and genomic tools for Xenopus research: The NIH Xenopus
            initiative
  JOURNAL   Dev. Dyn. 225 (4), 384-391 (2002)
   PUBMED   12454917
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from BC061606.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC061606.1, DT440324.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMD00028290, SAMD00028291
                                           [ECO:0000348]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..924
                     /organism="Xenopus tropicalis"
                     /mol_type="mRNA"
                     /db_xref="taxon:8364"
                     /chromosome="3"
                     /map="3"
     gene            1..924
                     /gene="btg1"
                     /gene_synonym="xbtg1"
                     /note="B-cell translocation gene 1, anti-proliferative"
                     /db_xref="GeneID:394522"
                     /db_xref="Xenbase:XB-GENE-1002920"
     misc_feature    83..85
                     /gene="btg1"
                     /gene_synonym="xbtg1"
                     /note="upstream in-frame stop codon"
     CDS             182..691
                     /gene="btg1"
                     /gene_synonym="xbtg1"
                     /codon_start=1
                     /product="protein BTG1"
                     /protein_id="NP_988926.1"
                     /db_xref="GeneID:394522"
                     /db_xref="Xenbase:XB-GENE-1002920"
                     /translation="
MHTHYPWANMKPEIMAAVSFISKFLRTKGLMNDLDLQTFNQSLQELLADHYKHHWFPEKPSRGSAYRCIRINHKMDPLIGEAADRIGLNSQQMFKLLPSELTLWVDPYEVSYRIGEDGSICVLYESVPGGGISPSSSGSLVESRISCKDELLLGRTSPSKTYNMMTVSG"
     misc_feature    209..553
                     /gene="btg1"
                     /gene_synonym="xbtg1"
                     /note="BTG family; Region: BTG; pfam07742"
                     /db_xref="CDD:462251"
ORIGIN      
attaacttgcacgccatgccagggcgcagcttgtaaaaccaccaaggacgtaaaagtgaaaaatataaaaaaaaaaaaattgtaaaacacgaataaaaatccatcaaacaggaccaagcggagcgcaatagacgatccgtgctgttccatcggtgttcgtatcgctgtcggtcgcgctcccatgcatacgcactatccctgggccaacatgaagccagagatcatggcggcggtgagtttcatctcaaagttcctccgaaccaaaggcctcatgaacgacctcgacctgcagacgtttaaccagtctttacaggagctcctggccgatcactataagcatcattggtttccagaaaagccgtcaaggggttcagcctatcgatgtattcggattaaccacaagatggaccctttaattggagaggcagcagatcgtattggactcaacagccagcaaatgtttaagcttctgccaagtgaacttactttgtgggttgacccatatgaagtatcgtatcgcataggagaggatggctctatttgtgtattgtatgaatctgttccaggaggtggtattagtccaagcagcagtggctctctagttgagagtaggatcagctgtaaagatgaactcctcttgggccgaacaagcccatccaaaacgtacaacatgatgactgtatctggttaagatatggttgatggctggatcatcttgtagcagatggaaaccaattattgtttttaatttgggagggctcctatggggatggattgtgaagtttatacaatgacgcagctgtgaagattggacacaaatagtggtagatctttctgaagtgaaagtgcctttgtttagacagtgtctttggcaattttatagcctgttatttacgcaaatagatttaaaaaaaaaaaaaaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]