LOCUS       NM_001007919            1645 bp    mRNA    linear   VRT 08-DEC-2024
DEFINITION  Xenopus tropicalis methyltransferase 14,
            N6-adenosine-methyltransferase non-catalytic subunit (mettl14),
            mRNA.
ACCESSION   NM_001007919
VERSION     NM_001007919.1
KEYWORDS    RefSeq.
SOURCE      Xenopus tropicalis (tropical clawed frog)
  ORGANISM  Xenopus tropicalis
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Amphibia; Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae;
            Xenopus; Silurana.
REFERENCE   1  (bases 1 to 1645)
  AUTHORS   Klein,S.L., Strausberg,R.L., Wagner,L., Pontius,J., Clifton,S.W.
            and Richardson,P.
  TITLE     Genetic and genomic tools for Xenopus research: The NIH Xenopus
            initiative
  JOURNAL   Dev Dyn 225 (4), 384-391 (2002)
   PUBMED   12454917
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from BC080361.1.
            
            Sequence Note: This sequence has been modified as follows: removed
            26 bp suspected to be vector contamination from the 3' end.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC080361.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMD00028290, SAMD00028291
                                           [ECO:0000348]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-1645              BC080361.1         1-1645
FEATURES             Location/Qualifiers
     source          1..1645
                     /organism="Xenopus tropicalis"
                     /mol_type="mRNA"
                     /db_xref="taxon:8364"
                     /chromosome="1"
                     /map="1"
     gene            1..1645
                     /gene="mettl14"
                     /note="methyltransferase 14,
                     N6-adenosine-methyltransferase non-catalytic subunit"
                     /db_xref="GeneID:493301"
                     /db_xref="Xenbase:XB-GENE-5813560"
     exon            1..230
                     /gene="mettl14"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    147..149
                     /gene="mettl14"
                     /note="upstream in-frame stop codon"
     CDS             165..1535
                     /gene="mettl14"
                     /EC_number="2.1.1.62"
                     /note="methyltransferase-like protein 14;
                     N6-adenosine-methyltransferase subunit METTL14;
                     methyltransferase like 14; N6-adenosine-methyltransferase
                     non-catalytic subunit; methyltransferase 14,
                     N6-adenosine-methyltransferase subunit"
                     /codon_start=1
                     /product="N(6)-adenosine-methyltransferase non-catalytic
                     subunit METTL14"
                     /protein_id="NP_001007920.1"
                     /db_xref="GeneID:493301"
                     /db_xref="Xenbase:XB-GENE-5813560"
                     /translation="

MNSRLQEIRARQTLRRKLLAQQLGAESADSIGAVLNSKDEQREIAETRETSRASYDTSATVSKRKMPEEGEADEEVIEECKDAVEPQKEEENLPYREEIYKDSSTFLKGTQSLNPHNDYCQHFVDTGHRPQNFIRDVGLADRFEEYPKLRELIRLKDELISKSNTPPMYLQADLESFDLRELKSEFDVILLEPPLEEYFRETGIAANEKWWTWEDIMKLDIEGIAGSRAFVFLWCGSGEGLDFGRMCLRKWGFRRSEDICWIKTNKDNPGKTKTLDPKAIFQRTKEHCLMGIKGTVHRSTDGDFIHANVDIDLIITEEPEIGNIEKPVEIFHIIEHFCLGRRRLHLFGRDSTIRPGWLTVGPTLTNSNFNSETYASYFNTPNSPLTGCTEEIERLRPKTPPPKSDRGFGASRGGGRGGPSAGRGERGRERNRGSFRGDRGNFRGRGGPHRGVFAPR"

     misc_feature    279..386
                     /gene="mettl14"
                     /note="propagated from UniProtKB/Swiss-Prot (Q66KJ9.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    567..572
                     /gene="mettl14"
                     /note="propagated from UniProtKB/Swiss-Prot (Q66KJ9.1);
                     Region: Interaction with METTL3.
                     /evidence=ECO:0000250|UniProtKB:Q9HCE5"
     misc_feature    600..602
                     /gene="mettl14"
                     /note="Interaction with METTL3.
                     /evidence=ECO:0000250|UniProtKB:Q9HCE5; propagated from
                     UniProtKB/Swiss-Prot (Q66KJ9.1); other site"
     misc_feature    720..1253
                     /gene="mettl14"
                     /note="Region: MT-A70; pfam05063"
                     /db_xref="CDD:368270"
     misc_feature    873..878
                     /gene="mettl14"
                     /note="propagated from UniProtKB/Swiss-Prot (Q66KJ9.1);
                     Region: Interaction with METTL3.
                     /evidence=ECO:0000250|UniProtKB:Q9HCE5"
     misc_feature    888..890
                     /gene="mettl14"
                     /note="Interaction with METTL3.
                     /evidence=ECO:0000250|UniProtKB:Q9HCE5; propagated from
                     UniProtKB/Swiss-Prot (Q66KJ9.1); other site"
     misc_feature    897..926
                     /gene="mettl14"
                     /note="propagated from UniProtKB/Swiss-Prot (Q66KJ9.1);
                     Region: Positively charged region required for
                     RNA-binding. /evidence=ECO:0000250|UniProtKB:Q9HCE5"
     misc_feature    897..899
                     /gene="mettl14"
                     /note="Interaction with METTL3.
                     /evidence=ECO:0000250|UniProtKB:Q9HCE5; propagated from
                     UniProtKB/Swiss-Prot (Q66KJ9.1); other site"
     misc_feature    927..938
                     /gene="mettl14"
                     /note="propagated from UniProtKB/Swiss-Prot (Q66KJ9.1);
                     Region: Interaction with METTL3.
                     /evidence=ECO:0000250|UniProtKB:Q9HCE5"
     misc_feature    996..1025
                     /gene="mettl14"
                     /note="propagated from UniProtKB/Swiss-Prot (Q66KJ9.1);
                     Region: Interaction with METTL3.
                     /evidence=ECO:0000250|UniProtKB:Q9HCE5"
     misc_feature    1053..1058
                     /gene="mettl14"
                     /note="propagated from UniProtKB/Swiss-Prot (Q66KJ9.1);
                     Region: Positively charged region required for
                     RNA-binding. /evidence=ECO:0000250|UniProtKB:Q9HCE5"
     misc_feature    1056..1058
                     /gene="mettl14"
                     /note="Interaction with METTL3.
                     /evidence=ECO:0000250|UniProtKB:Q9HCE5; propagated from
                     UniProtKB/Swiss-Prot (Q66KJ9.1); other site"
     misc_feature    1086..1100
                     /gene="mettl14"
                     /note="propagated from UniProtKB/Swiss-Prot (Q66KJ9.1);
                     Region: Interaction with METTL3.
                     /evidence=ECO:0000250|UniProtKB:Q9HCE5"
     misc_feature    1347..1532
                     /gene="mettl14"
                     /note="propagated from UniProtKB/Swiss-Prot (Q66KJ9.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     exon            231..319
                     /gene="mettl14"
                     /inference="alignment:Splign:2.1.0"
     exon            320..407
                     /gene="mettl14"
                     /inference="alignment:Splign:2.1.0"
     exon            408..488
                     /gene="mettl14"
                     /inference="alignment:Splign:2.1.0"
     exon            489..576
                     /gene="mettl14"
                     /inference="alignment:Splign:2.1.0"
     exon            577..667
                     /gene="mettl14"
                     /inference="alignment:Splign:2.1.0"
     exon            668..809
                     /gene="mettl14"
                     /inference="alignment:Splign:2.1.0"
     exon            810..902
                     /gene="mettl14"
                     /inference="alignment:Splign:2.1.0"
     exon            903..1019
                     /gene="mettl14"
                     /inference="alignment:Splign:2.1.0"
     exon            1020..1230
                     /gene="mettl14"
                     /inference="alignment:Splign:2.1.0"
     exon            1231..1645
                     /gene="mettl14"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

aaacatttctgcagattaaacaaatactggtttgcgtcgctaaatcaagtacacccaacagttcctcccctacaattggcggatgtgagtgacgtcaccgaatcgcgccaaaacaaccagaacaattggtgagaaagagttgggcttgaagggattctgaagaaatgaatagccgactccaggagatccgtgctcggcagacgctgcgccggaaactcctagcccagcaactgggagctgaaagtgctgacagtattggagctgtgcttaacagcaaggatgagcaaagggaaatcgctgaaacaagagaaactagccgtgcttcatatgacacatcagcaacagtttccaaacgcaaaatgcctgaagaaggggaagcagatgaagaggtgattgaggaatgtaaggatgcagtggaaccacagaaagaggaggaaaaccttccttatcgggaagaaatttataaagactcaagcacttttctaaagggaactcaaagcttgaatcctcataatgattactgccagcattttgttgacacaggacacaggccacaaaactttatcagagatgttggattagcagaccgatttgaagaatatcctaaacttcgggaattaatcagactaaaggatgagttaatatctaaatccaatactcctcccatgtacttacaagcagacctggagagctttgatctcagagagctgaagagtgagtttgacgtgatcctgcttgaacccccactggaggaatatttcagggagactggaattgcagctaatgaaaagtggtggacatgggaagatatcatgaaattggatatagaaggcattgcaggctccagggcgtttgttttcctttggtgcggctctggagagggcctggatttcggcagaatgtgcttgcgcaaatggggttttagaagatcagaagacatttgttggattaaaacaaacaaggacaatcctggaaaaacaaagactttagacccaaaggcaatcttccagaggacaaaggagcactgccttatgggtatcaagggaacagttcatcgcagcacagatggagatttcatccatgcaaatgttgacattgatctcatcatcacagaggagcctgaaattggaaacattgaaaagccagtggagatttttcacattattgagcatttctgccttggaaggagacggttacacctctttggaagggatagcactataaggccaggttggctcactgttggacctactcttaccaacagcaactttaattcagagacttacgcttcatacttcaacactccaaactcgcctcttactggatgcacagaggagattgaaagactgcgtcccaaaacaccgccacctaagtcagaccgtggatttggggcatcgagaggaggaggccgaggcggaccatctgcaggccggggagagaggggcagggaaaggaacagaggcagttttaggggagacagagggaatttcagaggacgtggaggaccacataggggtgtctttgccccccgctgattaaatacaaggacaggatttttttattttgcacttcttcatgtgtttgctattatttcaaggataaatattcctattaccctgaagattgtgcctctataataaattaa

//