2025-04-19 10:10:40, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS NM_001180759 1062 bp mRNA linear PLN 17-DEC-2024 DEFINITION Saccharomyces cerevisiae S288C Yhp1p (YHP1), partial mRNA. ACCESSION NM_001180759 VERSION NM_001180759.3 DBLINK BioProject: PRJNA128 KEYWORDS RefSeq. SOURCE Saccharomyces cerevisiae S288C ORGANISM Saccharomyces cerevisiae S288C Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces. REFERENCE 1 (bases 1 to 1062) AUTHORS Engel,S.R., Wong,E.D., Nash,R.S., Aleksander,S., Alexander,M., Douglass,E., Karra,K., Miyasato,S.R., Simison,M., Skrzypek,M.S., Weng,S. and Cherry,J.M. TITLE New data and collaborations at the Saccharomyces Genome Database: updated reference genome, alleles, and the Alliance of Genome Resources JOURNAL Genetics 220 (4) (2022) PUBMED 34897464 REFERENCE 2 (bases 1 to 1062) AUTHORS Jacq,C., Alt-Morbe,J., Andre,B., Arnold,W., Bahr,A., Ballesta,J.P., Bargues,M., Baron,L., Becker,A., Biteau,N., Blocker,H., Blugeon,C., Boskovic,J., Brandt,P., Bruckner,M., Buitrago,M.J., Coster,F., Delaveau,T., del Rey,F., Dujon,B., Eide,L.G., Garcia-Cantalejo,J.M., Goffeau,A., Gomez-Peris,A., Zaccaria,P. et al. TITLE The nucleotide sequence of Saccharomyces cerevisiae chromosome IV JOURNAL Nature 387 (6632 SUPPL), 75-78 (1997) PUBMED 9169867 REFERENCE 3 (bases 1 to 1062) AUTHORS Goffeau,A., Barrell,B.G., Bussey,H., Davis,R.W., Dujon,B., Feldmann,H., Galibert,F., Hoheisel,J.D., Jacq,C., Johnston,M., Louis,E.J., Mewes,H.W., Murakami,Y., Philippsen,P., Tettelin,H. and Oliver,S.G. TITLE Life with 6000 genes JOURNAL Science 274 (5287), 546 (1996) PUBMED 8849441 REFERENCE 4 (bases 1 to 1062) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (17-DEC-2024) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 5 (bases 1 to 1062) CONSRTM Saccharomyces Genome Database TITLE Direct Submission JOURNAL Submitted (16-JAN-2015) Department of Genetics, Stanford University, Stanford, CA 94305-5120, USA REMARK Protein update by submitter REFERENCE 6 (bases 1 to 1062) CONSRTM Saccharomyces Genome Database TITLE Direct Submission JOURNAL Submitted (06-FEB-2013) Department of Genetics, Stanford University, Stanford, CA 94305-5120, USA REMARK Protein update by submitter REFERENCE 7 (bases 1 to 1062) CONSRTM Saccharomyces Genome Database TITLE Direct Submission JOURNAL Submitted (04-MAY-2012) Department of Genetics, Stanford University, Stanford, CA 94305-5120, USA REMARK Protein update by submitter REFERENCE 8 (bases 1 to 1062) CONSRTM Saccharomyces Genome Database TITLE Direct Submission JOURNAL Submitted (31-MAR-2011) Department of Genetics, Stanford University, Stanford, CA 94305-5120, USA REMARK Sequence update by submitter REFERENCE 9 (bases 1 to 1062) CONSRTM Saccharomyces Genome Database TITLE Direct Submission JOURNAL Submitted (11-DEC-2009) Department of Genetics, Stanford University, Stanford, CA 94305-5120, USA COMMENT REVIEWED REFSEQ: This record has been curated by SGD. This record is derived from an annotated genomic sequence (NC_001136). On Jul 30, 2012 this sequence version replaced NM_001180759.2. ##Genome-Annotation-Data-START## Annotation Provider :: SGD Annotation Status :: Full Annotation Annotation Version :: R64-4-1 URL :: http://www.yeastgenome.org/ ##Genome-Annotation-Data-END## COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..1062 /organism="Saccharomyces cerevisiae S288C" /mol_type="mRNA" /strain="S288C" /db_xref="taxon:559292" /chromosome="IV" gene <1..>1062 /gene="YHP1" /locus_tag="YDR451C" /db_xref="GeneID:852062" CDS 1..1062 /gene="YHP1" /locus_tag="YDR451C" /experiment="EXISTENCE:direct assay:GO:0000785 chromatin [PMID:12464632]" /experiment="EXISTENCE:direct assay:GO:0000977 RNA polymerase II transcription regulatory region sequence-specific DNA binding [PMID:10705372|PMID:12464633]" /experiment="EXISTENCE:genetic interaction:GO:0000082 G1/S transition of mitotic cell cycle [PMID:12464633]" /experiment="EXISTENCE:genetic interaction:GO:0000122 negative regulation of transcription by RNA polymerase II [PMID:12464633]" /experiment="EXISTENCE:mutant phenotype:GO:0000122 negative regulation of transcription by RNA polymerase II [PMID:10705372]" /experiment="EXISTENCE:mutant phenotype:GO:0000977 RNA polymerase II transcription regulatory region sequence-specific DNA binding [PMID:12464633]" /note="Homeobox transcriptional repressor; binds Mcm1p and early cell cycle box (ECB) elements of cell cycle regulated genes, thereby restricting ECB-mediated transcription to the M/G1 interval; YHP1 has a paralog, YOX1, that arose from the whole genome duplication" /codon_start=1 /product="Yhp1p" /protein_id="NP_010739.3" /db_xref="GeneID:852062" /db_xref="SGD:S000002859" /translation="
MESRNTVLPSLPNIITGTSNSPFQLHTLPNTNFPSDDQGDIRLPPLAASAHIVRPVVNIYKSPCDEERPKRKSPQAVDFLSQRVTTSMTPLSKPKKLSSHSPFTPTVRVCSKEQPPQSMHSYKKVNILTPLSAAKAVLTPTTRKEKKRSFAFITHSQETFPKKEPKIDNARLARRKRRRTSSYELGILQTAFDECPTPNKAKRIELSEQCNMSEKSVQIWFQNKRQAAKKHKNSGNTSHCKVHSNDSMSMISYSDAALEITSTPTSTKEAITAELLKTSPANTSSIFEDHHITPCKPGGQLKFHRKSVLVKRTLSNTGHSEIIKSPKGKENRLKFNAYERKPLGEVDLNSFKN"
misc_feature 367..834 /gene="YHP1" /locus_tag="YDR451C" /note="Homeodomain-containing transcription factor [Transcription]; Region: COG5576" /db_xref="CDD:227863" ORIGIN
atggaaagcagaaataccgtgcttccttctttaccaaacattattacaggtacttctaattcgcctttccaactgcatactttgccaaatacaaacttccctagtgatgaccaaggtgacatcaggttgccaccattagctgcatctgcgcacattgtgagaccagtggtaaatatttataaaagtccttgcgatgaggaaaggccaaaaaggaaaagtccacaggctgtggatttcttatcacaacgtgtaaccacttccatgacgcctttatccaagcccaagaagctgagctctcattcaccattcacgccaacggtcagagtctgttctaaagagcagccacctcagagtatgcactcttataaaaaagttaatattcttactcctctatctgctgcaaaggctgttctcacaccaaccacaagaaaagaaaagaaaaggtcatttgcctttattacacactcacaggaaacttttccaaagaaggagcctaagatagacaatgctcggttagctcgtcggaaaagaagaagaacttcatcatatgagcttgggatattgcaaacagcatttgacgaatgtcccacgcccaataaggctaaaaggatagagttatccgagcaatgtaatatgtccgaaaaatcggttcaaatatggtttcagaacaaaaggcaggctgctaaaaagcacaagaacagtggcaacaccagccattgcaaagttcactctaatgattcgatgtctatgatatcttactcagacgctgcgttggaaattacctctacgccaacgagtacgaaggaggctattactgcagagttgctgaaaacttcacctgccaatacgtcctcgatcttcgaagaccaccacataacgccttgcaagcccggcggacagctcaagttccacaggaaatctgtgcttgttaagagaacattatcaaataccggtcatagcgagattatcaaaagtcctaaaggcaaggaaaaccgcctaaagttcaatgcatacgaaagaaaaccccttggggaggtcgatctcaattctttcaaaaactaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]