2024-11-22 23:46:30, GGRNA.v2 : RefSeq release 226 (Sep, 2024)
LOCUS XM_063274691 849 bp mRNA linear ROD 22-FEB-2024 DEFINITION PREDICTED: Rattus norvegicus glia maturation factor, beta (Gmfb), transcript variant X1, mRNA. ACCESSION XM_063274691 VERSION XM_063274691.1 DBLINK BioProject: PRJNA1074393 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_086033) annotated using gene prediction method: Gnomon, supported by EST evidence. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_036323735.1-RS_2024_02 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.2 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 02/09/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..849 /organism="Rattus norvegicus" /mol_type="mRNA" /strain="BN/NHsdMcwi" /bio_material="RGD 61498" /db_xref="taxon:10116" /chromosome="15" /sex="male" /tissue_type="kidney, spleen, liver" /geo_loc_name="USA: Wisconsin, Milwaukee" /lat_lon="43.05 N 88.04 W" /collected_by="Rebecca Schilling, Melinda Dwinell" gene 1..849 /gene="Gmfb" /note="glia maturation factor, beta; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 ESTs, 2 long SRA reads" /db_xref="GeneID:81661" /db_xref="RGD:70910" CDS 132..584 /gene="Gmfb" /codon_start=1 /product="glia maturation factor beta isoform X1" /protein_id="XP_063130761.1" /db_xref="GeneID:81661" /db_xref="RGD:70910" /translation="
MSESLVVCDVAEDLVEKLRKFRFRKETHNAAIIMKIDKDKRLVVLDEELEGVSPDELKDELPERQPRTFIVYSYKYQHDDGRVSYPLCFIFSSPLGCKPEQQMMYAGSKNKLVQTAELTKVLSRSDVLIDFPSQYSGRAKQPDAQVFSCS"
polyA_site 849 /gene="Gmfb" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN
gcggccgcgtagttaggtggggaacactgagctgtgtgccagccgaagcaggaagggaggtggctgcagagccattcttaaaggggcccaagagatcatacggcaacggacggctgacgaccggaaggaaaatgagtgagtctttggtggtttgtgatgttgctgaagatttagtggaaaagctgagaaagtttcgttttcgaaaagaaacccacaatgctgctattataatgaagattgacaaggataaacgcttggtggtgctggatgaggagctcgagggtgtctctccagatgaacttaaagatgaactacctgaacggcaacctcgaaccttcattgtgtatagttataaataccagcacgacgatggccgggtctcctaccctctgtgctttatcttctccagtcctctggggtgcaaacctgagcagcagatgatgtacgctgggagtaagaacaagctggtccagaccgccgagctaactaaggtactgtctaggtcggatgtgcttattgactttccttcccagtacagcgggagagccaagcagcctgatgcacaagtattttcctgtagctgaagcctgtagactgagacggtacattagtaaagcttcgaatgttataaggaaagaacagtagtgatctttgaaccaatgtgtttttaaacagtttgattagaaagaaaaaaacttatcaaaatttgagcagcttcagacaagccattgtggcgagtgcctgtaaacccagcactggagaagctgaggcaggagaattatgagttcaaggccactctgggccacataatgagattatctcccaagtaaaaataaaaggtcatggtaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]