2024-05-08 01:58:44, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_198685 693 bp mRNA linear ROD 24-NOV-2023 DEFINITION Rattus norvegicus cystatin S (Cyss), mRNA. ACCESSION NM_198685 XM_215879 VERSION NM_198685.2 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 693) AUTHORS Kajikawa S, Kigami D, Nakayama H and Doi K. TITLE Changes in submaxillary gland gene expression in F344 rats by multiple dosing of theophylline JOURNAL Exp Anim 55 (2), 143-146 (2006) PUBMED 16651698 REFERENCE 2 (bases 1 to 693) AUTHORS Iseki S, Kim JG, Kudo Y, Naito Y and Hipkaeo W. TITLE Impaired induction of cystatin S gene expression by isoproterenol in the submandibular gland of hypophysectomized rats JOURNAL Arch Oral Biol 50 (7), 653-660 (2005) PUBMED 15892951 REFERENCE 3 (bases 1 to 693) AUTHORS Shaw PA and Yu WH. TITLE Sympathetic and parasympathetic regulation of cystatin S gene expression JOURNAL Life Sci 70 (3), 301-313 (2001) PUBMED 12005263 REFERENCE 4 (bases 1 to 693) AUTHORS Nishiura T and Abe K. TITLE Postnatal changes of gene expression for tissue inhibitors of metalloproteinase-1 and -2 and cystatins S and C, in rat submandibular gland demonstrated by quantitative reverse transcription-polymerase chain reaction JOURNAL Arch Oral Biol 44 (1), 15-26 (1999) PUBMED 10075146 REFERENCE 5 (bases 1 to 693) AUTHORS Abe K, Okina A, Yano T, Gao C, Ohmori H, Ishibashi K, Nishiura T and Letic-Gavrilovic A. TITLE Abnormally high levels of cystatin S in submandibular glands, saliva, and gingiva of plaque-resistant rats JOURNAL J Dent Res 77 (11), 1913-1919 (1998) PUBMED 9823730 REFERENCE 6 (bases 1 to 693) AUTHORS Takahashi M, Honda Y, Ogawa K and Barka T. TITLE Immunofluorescence localization of cystatins in human lacrimal gland and in the exorbital lacrimal gland of the rat JOURNAL Acta Ophthalmol (Copenh) 70 (5), 625-631 (1992) PUBMED 1471486 REFERENCE 7 (bases 1 to 693) AUTHORS Cox JL and Shaw PA. TITLE Structure, organization and regulation of a rat cysteine proteinase inhibitor-encoding gene JOURNAL Gene 110 (2), 175-180 (1992) PUBMED 1537554 REFERENCE 8 (bases 1 to 693) AUTHORS Bedi GS. TITLE The effects of autonomic drugs on the concentration of kallikrein-like proteases and cysteine-proteinase inhibitor (cystatin) in rat whole saliva JOURNAL J Dent Res 70 (5), 924-930 (1991) PUBMED 2022776 REFERENCE 9 (bases 1 to 693) AUTHORS Bedi GS. TITLE The effect of adrenergic agonists and antagonists on cysteine-proteinase inhibitor (cystatin) in rat saliva JOURNAL Arch Oral Biol 36 (8), 611-618 (1991) PUBMED 1685882 REFERENCE 10 (bases 1 to 693) AUTHORS Shaw PA, Barka T, Woodin A, Schacter BS and Cox JL. TITLE Expression and induction by beta-adrenergic agonists of the cystatin S gene in submandibular glands of developing rats JOURNAL Biochem J 265 (1), 115-120 (1990) PUBMED 1967932 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from JACYVU010000119.1. On Oct 27, 2022 this sequence version replaced NM_198685.1. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: J04206.1 [ECO:0000332] RNAseq introns :: mixed sample support SAMN12840122, SAMN12840129 [ECO:0006172] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on single protein-coding transcript ##RefSeq-Attributes-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-272 JACYVU010000119.1 11091498-11091769 c 273-386 JACYVU010000119.1 11088472-11088585 c 387-693 JACYVU010000119.1 11087164-11087470 c FEATURES Location/Qualifiers source 1..693 /organism="Rattus norvegicus" /mol_type="mRNA" /strain="BN" /db_xref="taxon:10116" /chromosome="3" /map="3q41" gene 1..693 /gene="Cyss" /gene_synonym="Cst4" /note="cystatin S" /db_xref="GeneID:296234" /db_xref="RGD:735160" exon 1..272 /gene="Cyss" /gene_synonym="Cst4" /inference="alignment:Splign:2.1.0" misc_feature 24..26 /gene="Cyss" /gene_synonym="Cst4" /note="upstream in-frame stop codon" CDS 45..470 /gene="Cyss" /gene_synonym="Cst4" /note="LM protein; cystatin-1; protein LM" /codon_start=1 /product="cystatin-S precursor" /protein_id="NP_941958.1" /db_xref="GeneID:296234" /db_xref="RGD:735160" /translation="
MAYLLHAQLFLLTTFILVLNMRLCPVLGHFLGGIEKSSMEEEGASEALNYAVNEYNEKNSDLYLSRVVEVKDVQKQVVAGTKFFFDVILGKTICLKTQGDLTNCPLNEEADQQEHEFCSFVVHDIPWENYIVLLSSSCHSI"
sig_peptide 45..125 /gene="Cyss" /gene_synonym="Cst4" /note="/evidence=ECO:0000269|PubMed:2757396; propagated from UniProtKB/Swiss-Prot (P19313.2)" mat_peptide 126..467 /gene="Cyss" /gene_synonym="Cst4" /product="Cystatin-S. /id=PRO_0000006651" /note="propagated from UniProtKB/Swiss-Prot (P19313.2)" misc_feature 135..461 /gene="Cyss" /gene_synonym="Cst4" /note="Cystatin-like domain; Region: CY; smart00043" /db_xref="CDD:214484" misc_feature order(138..140,270..278,282..284) /gene="Cyss" /gene_synonym="Cst4" /note="putative proteinase inhibition site [active]" /db_xref="CDD:238002" misc_feature 138..140 /gene="Cyss" /gene_synonym="Cst4" /note="Reactive site; propagated from UniProtKB/Swiss-Prot (P19313.2); other site" misc_feature 270..284 /gene="Cyss" /gene_synonym="Cst4" /note="propagated from UniProtKB/Swiss-Prot (P19313.2); Region: Secondary area of contact" exon 273..386 /gene="Cyss" /gene_synonym="Cst4" /inference="alignment:Splign:2.1.0" exon 387..693 /gene="Cyss" /gene_synonym="Cst4" /inference="alignment:Splign:2.1.0" ORIGIN
gttcctctccttgtcttggatcctagtccatttctaagaagatcatggcctacctgctccatgctcaactatttctactgactacctttatattagttttgaacatgagactttgtcctgttctaggtcactttctgggtggcatagagaagtctagcatggaggaggaaggagcctcagaagcattgaactatgctgtcaatgaatataatgaaaagaacagtgacttgtacctgagccgtgtggtggaagtgaaggatgtccaaaagcaggtggtggctggaaccaaatttttctttgatgtgattctaggcaaaacaatatgtttgaagacacagggtgacttgaccaactgtcccttaaatgaagaggctgatcagcaggagcatgaattctgctctttcgtggttcatgatatcccatgggagaattatattgtcttgctgagctccagctgtcatagtatatgaattagtgtcaagtgttactgtgtaggatgcagatgtctctggcaatgcctcatcactccagtggatgatctttccttgatggatgcttaccagcatggatattagcaatggaatagactgctgtgcacttagagttagacccaagcacctctccctttattcttcctctacaaatgcccatatttgcttgctcattccttgctcaataaaatgtccaacagct
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]