LOCUS       NM_133540                813 bp    mRNA    linear   ROD 03-APR-2024
DEFINITION  Rattus norvegicus natural killer cell granule protein 7 (Nkg7),
            mRNA.
ACCESSION   NM_133540
VERSION     NM_133540.1
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 813)
  AUTHORS   Ji,L. and Guo,W.
  TITLE     Single-cell RNA sequencing highlights the roles of C1QB and NKG7 in
            the pancreatic islet immune microenvironment in type 1 diabetes
            mellitus
  JOURNAL   Pharmacol Res 187, 106588 (2023)
   PUBMED   36464147
  REMARK    GeneRIF: Single-cell RNA sequencing highlights the roles of C1QB
            and NKG7 in the pancreatic islet immune microenvironment in type 1
            diabetes mellitus.
REFERENCE   2  (bases 1 to 813)
  AUTHORS   Berg,S.F., Westgaard,I.H., Fossum,S. and Dissen,E.
  TITLE     A rat gene homologous to human granule membrane protein 17 is
            expressed by natural killer cells, CD8(+) T cells, and a mast cell
            line
  JOURNAL   Immunogenetics 49 (9), 815-818 (1999)
   PUBMED   10398810
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from AF082535.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AF082535.1, FQ222255.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA5760383, SAMEA5760389
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..813
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /strain="PVG"
                     /db_xref="taxon:10116"
                     /chromosome="1"
                     /map="1q22"
     gene            1..813
                     /gene="Nkg7"
                     /note="natural killer cell granule protein 7"
                     /db_xref="GeneID:171062"
                     /db_xref="RGD:621523"
     exon            1..301
                     /gene="Nkg7"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    1..3
                     /gene="Nkg7"
                     /note="upstream in-frame stop codon"
     CDS             145..642
                     /gene="Nkg7"
                     /note="natural killer cell group 7 sequence"
                     /codon_start=1
                     /product="protein NKG7"
                     /protein_id="NP_598224.1"
                     /db_xref="GeneID:171062"
                     /db_xref="RGD:621523"
                     /translation="

MEPYRSLALLAGCLGLIFSLIALSTDFWIVATGPNFSAHSGLWPTSPGTQVAGYIHVTQVCCILAALWGLVSVSFLVLSCIPSLSAPGRGPMVSTVLSFAAALSIIVAMAVYTSERWSQPPSPQVQTFFSWSFYLGWGSAIPFLCAGCLSLGAHCRTRRTEYETL"

     misc_feature    205..567
                     /gene="Nkg7"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; cl21598"
                     /db_xref="CDD:473919"
     exon            302..448
                     /gene="Nkg7"
                     /inference="alignment:Splign:2.1.0"
     exon            449..583
                     /gene="Nkg7"
                     /inference="alignment:Splign:2.1.0"
     exon            584..798
                     /gene="Nkg7"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

tgacaaagtcactgcttgctggctgtttctctggctcagtggactagaagtccaggtgcatggccttttcctttttctaagagccaacactctgggtcatctgtgtctttgtcccctaagaagtggaaacccagagctgtgtccatggagccctaccggtccctggccctgcttgctggctgtctgggcctgattttttcactgattgctctgagcactgacttctggatagtggccaccggccccaacttctctgcccactctggcctctggccaacaagcccagggactcaagtagcaggttatatccacgtgacacaggtctgctgtatcctggctgccctgtggggcctggtatccgtgagcttcctggttctgtcttgtatcccatccctgtctgctcctggccgtggccctatggtctcaactgtcttgtcttttgctgcagctctctccatcatagtggccatggcagtgtacaccagcgagagatggagccagcctccatctccccaggtccagacattcttctcctggtccttctacctaggctggggctccgccatccctttcctctgtgcaggctgcctgagcctgggtgctcactgtagaacccgtcggactgagtacgaaaccttgtgaacagaagccaaggacatcagggtcagcaggatgtttggagccttgtcctctcagaagctataaaaggaaggcagaattctgtttctgtccctcccaccttgccttatccctcaattgctttcttcacacactcaataaaagcatgccgagatctaaaaaaaaaaaaaaaaa

//