ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2026-01-18 13:20:30, GGRNA.v2 : RefSeq release 232 (Sep, 2025)
LOCUS NM_030847 729 bp mRNA linear ROD 05-MAY-2025
DEFINITION Rattus norvegicus epithelial membrane protein 3 (Emp3), mRNA.
ACCESSION NM_030847
VERSION NM_030847.2
KEYWORDS RefSeq; RefSeq Select.
SOURCE Rattus norvegicus (Norway rat)
ORGANISM Rattus norvegicus
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
Muroidea; Muridae; Murinae; Rattus.
REFERENCE 1 (bases 1 to 729)
AUTHORS Wilson,H.L., Wilson,S.A., Surprenant,A. and North,R.A.
TITLE Epithelial membrane proteins induce membrane blebbing and interact
with the P2X7 receptor C terminus
JOURNAL J Biol Chem 277 (37), 34017-34023 (2002)
PUBMED 12107182
REFERENCE 2 (bases 1 to 729)
AUTHORS Zucchi,I., Montagna,C., Susani,L., Montesano,R., Affer,M.,
Zanotti,S., Redolfi,E., Vezzoni,P. and Dulbecco,R.
TITLE Genetic dissection of dome formation in a mammary cell line:
identification of two genes with opposing action
JOURNAL Proc Natl Acad Sci U S A 96 (24), 13766-13770 (1999)
PUBMED 10570147
COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final
NCBI review. The reference sequence was derived from
JAXUCZ010000001.1.
On Nov 26, 2020 this sequence version replaced NM_030847.1.
##Evidence-Data-START##
Transcript exon combination :: Y10889.2, DV721162.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
SAMN16676807, SAMN16676810
[ECO:0000348]
##Evidence-Data-END##
##RefSeq-Attributes-START##
RefSeq Select criteria :: based on conservation, expression,
longest protein
##RefSeq-Attributes-END##
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-40 JAXUCZ010000001.1 105528226-105528265 c
41-277 JAXUCZ010000001.1 105527218-105527454 c
278-380 JAXUCZ010000001.1 105526903-105527005 c
381-521 JAXUCZ010000001.1 105526299-105526439 c
522-729 JAXUCZ010000001.1 105525088-105525295 c
FEATURES Location/Qualifiers
source 1..729
/organism="Rattus norvegicus"
/mol_type="mRNA"
/strain="BN"
/db_xref="taxon:10116"
/chromosome="1"
/map="1q22"
gene 1..729
/gene="Emp3"
/note="epithelial membrane protein 3"
/db_xref="GeneID:81505"
/db_xref="RGD:621094"
exon 1..40
/gene="Emp3"
/inference="alignment:Splign:2.1.0"
exon 41..277
/gene="Emp3"
/inference="alignment:Splign:2.1.0"
misc_feature 101..103
/gene="Emp3"
/note="upstream in-frame stop codon"
CDS 200..691
/gene="Emp3"
/note="EMP-3"
/codon_start=1
/product="epithelial membrane protein 3"
/protein_id="NP_110474.1"
/db_xref="GeneID:81505"
/db_xref="RGD:621094"
/translation="
MSLLLLVVSALHILILVLLFVATLDKSWWTLPEKESLNLWYDCTWNTTAKTWACSNVSENGWLKAVQALMVLSLILCCLSFILFMIQLYTMRRGGLFYATGLCQLCTSAAVFSGALIYAIHAKEILAKHPSGGSFGYCFALAWVAFPLALVSGIIYIHLRKRE"
misc_feature 209..271
/gene="Emp3"
/note="propagated from UniProtKB/Swiss-Prot (Q9QYW5.1);
transmembrane region"
misc_feature 233..667
/gene="Emp3"
/note="PMP-22/EMP/MP20/Claudin family; Region:
PMP22_Claudin; cl21598"
/db_xref="CDD:473919"
misc_feature 335..337
/gene="Emp3"
/note="N-linked (GlcNAc...) asparagine.
/evidence=ECO:0000255; propagated from
UniProtKB/Swiss-Prot (Q9QYW5.1); glycosylation site"
misc_feature 365..367
/gene="Emp3"
/note="N-linked (GlcNAc...) asparagine.
/evidence=ECO:0000255; propagated from
UniProtKB/Swiss-Prot (Q9QYW5.1); glycosylation site"
misc_feature 395..457
/gene="Emp3"
/note="propagated from UniProtKB/Swiss-Prot (Q9QYW5.1);
transmembrane region"
misc_feature 497..559
/gene="Emp3"
/note="propagated from UniProtKB/Swiss-Prot (Q9QYW5.1);
transmembrane region"
misc_feature 614..676
/gene="Emp3"
/note="propagated from UniProtKB/Swiss-Prot (Q9QYW5.1);
transmembrane region"
exon 278..380
/gene="Emp3"
/inference="alignment:Splign:2.1.0"
exon 381..521
/gene="Emp3"
/inference="alignment:Splign:2.1.0"
exon 522..729
/gene="Emp3"
/inference="alignment:Splign:2.1.0"
ORIGIN
cgaggacagactccaactctgacttcttcagcgactctcgagacttcccgaaccaagccgtctttcctcagaccttacagtcctccccagccttcctctctgacttagagagccagaccccagccctcttcccccaggattgagtgctccgacccttcgaaggcttgcctctcctgctctgagccagcatctggcagccatgtcactcctcctgttggtggtctctgcccttcacatcctcattcttgtcttgcttttcgtggccactctggacaagtcctggtggactctcccagagaaggagtccctgaacctgtggtatgactgcacgtggaacaccaccgctaaaacgtgggcctgcagtaacgtcagtgagaacggctggctgaaggcagtgcaggcgctcatggtgctgtctctcatcctctgctgtctgtccttcatcctcttcatgatccaactctacaccatgcggagaggagggctcttctacgccaccggcctctgccagctctgcaccagtgcggctgtgttctccggggcactgatctatgccatccatgctaaggagatcctggcaaagcacccgagtggaggcagcttcggctactgcttcgccctggcctgggtggcctttccactcgccctggtcagtggcatcatctacatccacctgcggaaacgagaatgagcgctgtgtccccctagaaaataaagccctgtaaccac
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]