LOCUS       NM_030847                729 bp    mRNA    linear   ROD 05-MAY-2025
DEFINITION  Rattus norvegicus epithelial membrane protein 3 (Emp3), mRNA.
ACCESSION   NM_030847
VERSION     NM_030847.2
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 729)
  AUTHORS   Wilson,H.L., Wilson,S.A., Surprenant,A. and North,R.A.
  TITLE     Epithelial membrane proteins induce membrane blebbing and interact
            with the P2X7 receptor C terminus
  JOURNAL   J Biol Chem 277 (37), 34017-34023 (2002)
   PUBMED   12107182
REFERENCE   2  (bases 1 to 729)
  AUTHORS   Zucchi,I., Montagna,C., Susani,L., Montesano,R., Affer,M.,
            Zanotti,S., Redolfi,E., Vezzoni,P. and Dulbecco,R.
  TITLE     Genetic dissection of dome formation in a mammary cell line:
            identification of two genes with opposing action
  JOURNAL   Proc Natl Acad Sci U S A 96 (24), 13766-13770 (1999)
   PUBMED   10570147
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from
            JAXUCZ010000001.1.
            
            On Nov 26, 2020 this sequence version replaced NM_030847.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: Y10889.2, DV721162.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN16676807, SAMN16676810
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on conservation, expression,
                                      longest protein
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-40                JAXUCZ010000001.1  105528226-105528265 c
            41-277              JAXUCZ010000001.1  105527218-105527454 c
            278-380             JAXUCZ010000001.1  105526903-105527005 c
            381-521             JAXUCZ010000001.1  105526299-105526439 c
            522-729             JAXUCZ010000001.1  105525088-105525295 c
FEATURES             Location/Qualifiers
     source          1..729
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /strain="BN"
                     /db_xref="taxon:10116"
                     /chromosome="1"
                     /map="1q22"
     gene            1..729
                     /gene="Emp3"
                     /note="epithelial membrane protein 3"
                     /db_xref="GeneID:81505"
                     /db_xref="RGD:621094"
     exon            1..40
                     /gene="Emp3"
                     /inference="alignment:Splign:2.1.0"
     exon            41..277
                     /gene="Emp3"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    101..103
                     /gene="Emp3"
                     /note="upstream in-frame stop codon"
     CDS             200..691
                     /gene="Emp3"
                     /note="EMP-3"
                     /codon_start=1
                     /product="epithelial membrane protein 3"
                     /protein_id="NP_110474.1"
                     /db_xref="GeneID:81505"
                     /db_xref="RGD:621094"
                     /translation="

MSLLLLVVSALHILILVLLFVATLDKSWWTLPEKESLNLWYDCTWNTTAKTWACSNVSENGWLKAVQALMVLSLILCCLSFILFMIQLYTMRRGGLFYATGLCQLCTSAAVFSGALIYAIHAKEILAKHPSGGSFGYCFALAWVAFPLALVSGIIYIHLRKRE"

     misc_feature    209..271
                     /gene="Emp3"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9QYW5.1);
                     transmembrane region"
     misc_feature    233..667
                     /gene="Emp3"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; cl21598"
                     /db_xref="CDD:473919"
     misc_feature    335..337
                     /gene="Emp3"
                     /note="N-linked (GlcNAc...) asparagine.
                     /evidence=ECO:0000255; propagated from
                     UniProtKB/Swiss-Prot (Q9QYW5.1); glycosylation site"
     misc_feature    365..367
                     /gene="Emp3"
                     /note="N-linked (GlcNAc...) asparagine.
                     /evidence=ECO:0000255; propagated from
                     UniProtKB/Swiss-Prot (Q9QYW5.1); glycosylation site"
     misc_feature    395..457
                     /gene="Emp3"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9QYW5.1);
                     transmembrane region"
     misc_feature    497..559
                     /gene="Emp3"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9QYW5.1);
                     transmembrane region"
     misc_feature    614..676
                     /gene="Emp3"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9QYW5.1);
                     transmembrane region"
     exon            278..380
                     /gene="Emp3"
                     /inference="alignment:Splign:2.1.0"
     exon            381..521
                     /gene="Emp3"
                     /inference="alignment:Splign:2.1.0"
     exon            522..729
                     /gene="Emp3"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

cgaggacagactccaactctgacttcttcagcgactctcgagacttcccgaaccaagccgtctttcctcagaccttacagtcctccccagccttcctctctgacttagagagccagaccccagccctcttcccccaggattgagtgctccgacccttcgaaggcttgcctctcctgctctgagccagcatctggcagccatgtcactcctcctgttggtggtctctgcccttcacatcctcattcttgtcttgcttttcgtggccactctggacaagtcctggtggactctcccagagaaggagtccctgaacctgtggtatgactgcacgtggaacaccaccgctaaaacgtgggcctgcagtaacgtcagtgagaacggctggctgaaggcagtgcaggcgctcatggtgctgtctctcatcctctgctgtctgtccttcatcctcttcatgatccaactctacaccatgcggagaggagggctcttctacgccaccggcctctgccagctctgcaccagtgcggctgtgttctccggggcactgatctatgccatccatgctaaggagatcctggcaaagcacccgagtggaggcagcttcggctactgcttcgccctggcctgggtggcctttccactcgccctggtcagtggcatcatctacatccacctgcggaaacgagaatgagcgctgtgtccccctagaaaataaagccctgtaaccac

//