2024-05-07 19:19:14, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_012923 3198 bp mRNA linear ROD 20-MAR-2023 DEFINITION Rattus norvegicus cyclin G1 (Ccng1), mRNA. ACCESSION NM_012923 VERSION NM_012923.2 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 3198) AUTHORS Liu Y, Fu X, Wang X, Liu Y and Song X. TITLE Long non-coding RNA OIP5-AS1 facilitates the progression of ovarian cancer via the miR-128-3p/CCNG1 axis JOURNAL Mol Med Rep 23 (5) (2021) PUBMED 33760168 REFERENCE 2 (bases 1 to 3198) AUTHORS Xu G, Bu S, Wang X and Ge H. TITLE Silencing the Expression of Cyclin G1 Enhances the Radiosensitivity of Hepatocellular Carcinoma In Vitro and In Vivo by Inducing Apoptosis JOURNAL Radiat Res 195 (4), 378-384 (2021) PUBMED 33543294 REFERENCE 3 (bases 1 to 3198) AUTHORS Guo JY, Wang XQ and Sun LF. TITLE MicroRNA-488 inhibits ovarian cancer cell metastasis through regulating CCNG1 and p53 expression JOURNAL Eur Rev Med Pharmacol Sci 24 (6), 2902-2910 (2020) PUBMED 32271408 REFERENCE 4 (bases 1 to 3198) AUTHORS Xu Y, Zhang Q, Miao C, Dongol S, Li Y, Jin C, Dong R, Li Y, Yang X and Kong B. TITLE CCNG1 (Cyclin G1) regulation by mutant-P53 via induction of Notch3 expression promotes high-grade serous ovarian cancer (HGSOC) tumorigenesis and progression JOURNAL Cancer Med 8 (1), 351-362 (2019) PUBMED 30565428 REFERENCE 5 (bases 1 to 3198) AUTHORS Ohno S, Ikeda JI, Naito Y, Okuzaki D, Sasakura T, Fukushima K, Nishikawa Y, Ota K, Kato Y, Wang M, Torigata K, Kasama T, Uchihashi T, Miura D, Yabuta N, Morii E and Nojima H. TITLE Comprehensive phenotypic analysis of knockout mice deficient in cyclin G1 and cyclin G2 JOURNAL Sci Rep 6, 39091 (2016) PUBMED 27982046 REMARK Publication Status: Online-Only REFERENCE 6 (bases 1 to 3198) AUTHORS Chen DS, Zhu NL, Hung G, Skotzko MJ, Hinton DR, Tolo V, Hall FL, Anderson WF and Gordon EM. TITLE Retroviral vector-mediated transfer of an antisense cyclin G1 construct inhibits osteosarcoma tumor growth in nude mice JOURNAL Hum Gene Ther 8 (14), 1667-1674 (1997) PUBMED 9322869 REFERENCE 7 (bases 1 to 3198) AUTHORS Zhu NL, Wu L, Liu PX, Gordon EM, Anderson WF, Starnes VA and Hall FL. TITLE Downregulation of cyclin G1 expression by retrovirus-mediated antisense gene transfer inhibits vascular smooth muscle cell proliferation and neointima formation JOURNAL Circulation 96 (2), 628-635 (1997) PUBMED 9244236 REFERENCE 8 (bases 1 to 3198) AUTHORS Endo Y, Fujita T, Tamura K, Tsuruga H and Nojima H. TITLE Structure and chromosomal assignment of the human cyclin G gene JOURNAL Genomics 38 (1), 92-95 (1996) PUBMED 8954786 REFERENCE 9 (bases 1 to 3198) AUTHORS Zauberman A, Lupo A and Oren M. TITLE Identification of p53 target genes through immune selection of genomic DNA: the cyclin G gene contains two distinct p53 binding sites JOURNAL Oncogene 10 (12), 2361-2366 (1995) PUBMED 7784084 REFERENCE 10 (bases 1 to 3198) AUTHORS Tamura K, Kanaoka Y, Jinno S, Nagata A, Ogiso Y, Shimizu K, Hayakawa T, Nojima H and Okayama H. TITLE Cyclin G: a new mammalian cyclin with homology to fission yeast Cig1 JOURNAL Oncogene 8 (8), 2113-2118 (1993) PUBMED 8336937 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from CB805791.1 and BC081852.1. On Jan 9, 2008 this sequence version replaced NM_012923.1. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: BC081852.1, FQ211975.1 [ECO:0000332] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on single protein-coding transcript ##RefSeq-Attributes-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-29 CB805791.1 22-50 30-3198 BC081852.1 1-3169 FEATURES Location/Qualifiers source 1..3198 /organism="Rattus norvegicus" /mol_type="mRNA" /db_xref="taxon:10116" /chromosome="10" /map="10q12" gene 1..3198 /gene="Ccng1" /gene_synonym="Ccng; CYCG" /note="cyclin G1" /db_xref="GeneID:25405" /db_xref="RGD:2295" exon 1..231 /gene="Ccng1" /gene_synonym="Ccng; CYCG" /inference="alignment:Splign:2.1.0" misc_feature 145..147 /gene="Ccng1" /gene_synonym="Ccng; CYCG" /note="upstream in-frame stop codon" CDS 232..1116 /gene="Ccng1" /gene_synonym="Ccng; CYCG" /note="cyclin-G" /codon_start=1 /product="cyclin-G1" /protein_id="NP_037055.1" /db_xref="GeneID:25405" /db_xref="RGD:2295" /translation="
MIEVLTTDSQKLLHQLNTLLEQESRCQPKVCGLKLIESAHDNGLRMTARLRDFEVKDLLSLTQFFGFDTETFSLAVNLLDRFLSKMKVQAKHLGCVGLSCFYLAVKSIEEERNVPLATDLIRISQYRFTVSDLMRMEKIVLEKVCWKVKATTAFQFLQLYYSLIRETLPFERRNDLNFERLEAQLKACHCRIIFSKAKPSVLALAIIALEIQALKYVELTEGVECIQKHSKISGRDLTFWQELVSKCLTEYSSNKCSKPNGQKLKWIVSGRTARQLKHSYYRITHLPTIPETMG"
misc_feature 379..672 /gene="Ccng1" /gene_synonym="Ccng; CYCG" /note="cyclin box found in cyclin-G1 (CCNG1) and similar proteins; Region: CYCLIN_CCNG1; cd20583" /db_xref="CDD:410286" exon 232..492 /gene="Ccng1" /gene_synonym="Ccng; CYCG" /inference="alignment:Splign:2.1.0" exon 493..746 /gene="Ccng1" /gene_synonym="Ccng; CYCG" /inference="alignment:Splign:2.1.0" exon 747..825 /gene="Ccng1" /gene_synonym="Ccng; CYCG" /inference="alignment:Splign:2.1.0" exon 826..924 /gene="Ccng1" /gene_synonym="Ccng; CYCG" /inference="alignment:Splign:2.1.0" exon 925..3198 /gene="Ccng1" /gene_synonym="Ccng; CYCG" /inference="alignment:Splign:2.1.0" ORIGIN
tctccccgcggccgggcgcagtccttcaccgcacgctgaaccggaggaaggctgcgcctagtcggggcgctgagggaccctccaccgggacgccggcccctccccgggcctctgctcacttgcccccctgcgagcccgtccccctagtcggcctctcggatcggggacgtggggcgagctgagagcaggcccggggtgggtggtcactgtggagaagacgtggctgtcaagatgatagaagtactgacaactgactctcagaaactgctacaccagctgaacaccctgttggaacaggagtccagatgtcagccaaaggtctgtggcctgaaactgattgagtctgcacatgataatggcctcaggatgactgcaagactccgggactttgaagtcaaagatctactgagtctaactcagttctttggcttcgacacagaaacattttcccttgctgtgaatttactggacagattcttgtctaaaatgaaggtacaggcgaagcatctcggctgtgtcggactgagctgcttttatttggctgtgaaatcgattgaagaggaaaggaacgtcccgctggcaactgatttgatccggataagtcagtataggttcacagtttcagacctgatgagaatggaaaagattgtgttggagaaagtgtgctggaaagtcaaagctactactgccttccaatttctgcagctctattactccctcattcgggagaccttgccatttgaaaggagaaacgatctgaattttgaaagactagaagcccaactgaaggcgtgccactgcaggatcatattttctaaggcaaagccttctgtgctggcgctggcaatcatcgctttggagatccaagcactgaagtatgtggagttaacagaaggagtagaatgtattcagaaacattccaagataagtggccgagatctgaccttctggcaagagcttgtttccaagtgtttaactgaatattcatcaaacaagtgttccaagccgaacggtcagaagttaaaatggatcgtgtctgggcgcactgcacgacaactgaagcacagttattacaggataacccacctcccaacaattcccgaaaccatgggttagttggcaaatctggttgttatcctctgtgtacagaacatttcccagtgagatcgtttttgtgctataacttaaggattgaaatactaccttcaatataaagaatacaggatgaaaacagtaaaggaaacgtgagtttgttggtctagacagagaatactgggaggcattcactgtgtaccgcagtctgaagagaaatgagtatcaaacctctagacacatgctcatactgctgtcaaaggactagcgtagaaaagagagtcctccaaaccggaagtttaaatgtagttactaaaatagcacttctttaacttacatatccccccactgtggcttatttaaagttacagaagtccaagcagaacgacaaaagatgtgacccatatatgaacacattttaatctgttcattgattaggagagtgaatatgaacttgcatgatgcccatgttaggtttctggaaactgccggggtatcttaattctctagtattctccctctgtggcagttgggctaatacaaagtaactatacgcatgagaatataaaatcagtctctgatacatacacatttttaccatcaaaatttcttaatcatagcaaagacttacctttttatgattaggaattttttttttaatgtatggcagcacatgcctttaatcccaacactagggaggcagaggcaggtggatctctttgagttcgaagccaggctggtctttacagtgagttccaggacagctggagagctacagaatggagagacgctgtctcaaaaacactgaaaacaaacaaacaaaccataccagtttgtaggcagacttctgttgggttgggtttgtactgtttgcctatgcagtgggattacagcagcagcaacaaaaactgtccctgaagtctttctctgccactgtgacctgagtttcctatggtacgcgatttattctaagaaacctcagcccctcaccacgttagctgttggcaaatggcctcacagttgcggaaagtcccaattctaggcttgggaaagcaatgcttagatttgaattggcccatgaagcattcaaatcaaggctaaagacataaatgtgaaataaaactgtgaaccttcattttaacattgatctcacttcccagatttaatcaatatatacttaggtggtattaaaaatggtaaactgcctaatttaaatctcaaaatttaaactatgaggtttacatcaaagccaacatttcacaaatgtacttttaaggtattaaaagaggtatttaagcagtaaatggtttcttggcacccataaccaagtaatagttaagttagaggtgggacttttttattgctatgagaattacatttaaacttttgggtgttttataaaaagcagatttcacaagttttgaaaattgtgacctttactgaaatttgttacctttaatatttcttctagaggataggtatttataaaagaaaaattcgtcagaattgctgcctcaatctagtcccatttgagaaaatttgtttctactgtctcaataactggatgaaatatcactctgaaaacttgcctattgcactaaagctagtttaggcttgataaaacactccaggaggtttttaccacagactgtttctattaaaactgctgcttctcatgtacaattttgttttaaaaggaaccgagtacatctgcaaaacctaagtcttaagggacgtcaggaggtaccttcagaattataggatcaccatggtagtggggattctccatgctggccttgaatgtttgatcttcactgctgaaatgtgggtagctcctcagcgccctgtagagcctgagtctacctagaatagctgtaaccattttgacaagtaatggataagaaaattatccattgagaagctaaaaacaaaacaaaacaaaaccaaagaacgggtgtattttattcttaacctttgtaaaccatcactgagaacacttcagttcttcctaacagctgttatgcttcgatttgaaaaaaatactgagtggataaccaactaccatcatgctttgggtacacctttcaataaaattactgaaatgca
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]