2024-05-03 18:17:39, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_001399252 1620 bp mRNA linear ROD 23-MAR-2023 DEFINITION Rattus norvegicus angiopoietin-like 3 (Angptl3), transcript variant 1, mRNA. ACCESSION NM_001399252 XM_006238440 VERSION NM_001399252.1 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 1620) AUTHORS Zhao Y, Goto M, Vaziri ND, Khazaeli M, Liu H, Farahanchi N, Khanifar E, Farzaneh T, Haslett PA, Moradi H and Soundarapandian MM. TITLE RNA Interference Targeting Liver Angiopoietin-Like Protein 3 Protects from Nephrotic Syndrome in a Rat Model Via Amelioration of Pathologic Hypertriglyceridemia JOURNAL J Pharmacol Exp Ther 376 (3), 428-435 (2021) PUBMED 33443084 REMARK GeneRIF: RNA Interference Targeting Liver Angiopoietin-Like Protein 3 Protects from Nephrotic Syndrome in a Rat Model Via Amelioration of Pathologic Hypertriglyceridemia. REFERENCE 2 (bases 1 to 1620) AUTHORS Essalmani R, Susan-Resiga D, Chamberland A, Asselin MC, Canuel M, Constam D, Creemers JW, Day R, Gauthier D, Prat A and Seidah NG. TITLE Furin is the primary in vivo convertase of angiopoietin-like 3 and endothelial lipase in hepatocytes JOURNAL J Biol Chem 288 (37), 26410-26418 (2013) PUBMED 23918928 REFERENCE 3 (bases 1 to 1620) AUTHORS Quagliarini F, Wang Y, Kozlitina J, Grishin NV, Hyde R, Boerwinkle E, Valenzuela DM, Murphy AJ, Cohen JC and Hobbs HH. TITLE Atypical angiopoietin-like protein that regulates ANGPTL3 JOURNAL Proc Natl Acad Sci U S A 109 (48), 19751-19756 (2012) PUBMED 23150577 REFERENCE 4 (bases 1 to 1620) AUTHORS Sonnenburg WK, Yu D, Lee EC, Xiong W, Gololobov G, Key B, Gay J, Wilganowski N, Hu Y, Zhao S, Schneider M, Ding ZM, Zambrowicz BP, Landes G, Powell DR and Desai U. TITLE GPIHBP1 stabilizes lipoprotein lipase and prevents its inhibition by angiopoietin-like 3 and angiopoietin-like 4 JOURNAL J Lipid Res 50 (12), 2421-2429 (2009) PUBMED 19542565 REFERENCE 5 (bases 1 to 1620) AUTHORS Shimamura M, Matsuda M, Yasumo H, Okazaki M, Fujimoto K, Kono K, Shimizugawa T, Ando Y, Koishi R, Kohama T, Sakai N, Kotani K, Komuro R, Ishida T, Hirata K, Yamashita S, Furukawa H and Shimomura I. TITLE Angiopoietin-like protein3 regulates plasma HDL cholesterol through suppression of endothelial lipase JOURNAL Arterioscler Thromb Vasc Biol 27 (2), 366-372 (2007) PUBMED 17110602 REFERENCE 6 (bases 1 to 1620) AUTHORS Inaba T, Matsuda M, Shimamura M, Takei N, Terasaka N, Ando Y, Yasumo H, Koishi R, Makishima M and Shimomura I. TITLE Angiopoietin-like protein 3 mediates hypertriglyceridemia induced by the liver X receptor JOURNAL J Biol Chem 278 (24), 21344-21351 (2003) PUBMED 12672813 REFERENCE 7 (bases 1 to 1620) AUTHORS Ando Y, Shimizugawa T, Takeshita S, Ono M, Shimamura M, Koishi R and Furukawa H. TITLE A decreased expression of angiopoietin-like 3 is protective against atherosclerosis in apoE-deficient mice JOURNAL J Lipid Res 44 (6), 1216-1223 (2003) PUBMED 12671033 REFERENCE 8 (bases 1 to 1620) AUTHORS Shimamura M, Matsuda M, Kobayashi S, Ando Y, Ono M, Koishi R, Furukawa H, Makishima M and Shimomura I. TITLE Angiopoietin-like protein 3, a hepatic secretory factor, activates lipolysis in adipocytes JOURNAL Biochem Biophys Res Commun 301 (2), 604-609 (2003) PUBMED 12565906 REFERENCE 9 (bases 1 to 1620) AUTHORS Shimizugawa T, Ono M, Shimamura M, Yoshida K, Ando Y, Koishi R, Ueda K, Inaba T, Minekura H, Kohama T and Furukawa H. TITLE ANGPTL3 decreases very low density lipoprotein triglyceride clearance by inhibition of lipoprotein lipase JOURNAL J Biol Chem 277 (37), 33742-33748 (2002) PUBMED 12097324 REFERENCE 10 (bases 1 to 1620) AUTHORS Camenisch G, Pisabarro MT, Sherman D, Kowalski J, Nagel M, Hass P, Xie MH, Gurney A, Bodary S, Liang XH, Clark K, Beresini M, Ferrara N and Gerber HP. TITLE ANGPTL3 stimulates endothelial cell adhesion and migration via integrin alpha vbeta 3 and induces blood vessel formation in vivo JOURNAL J Biol Chem 277 (19), 17281-17290 (2002) PUBMED 11877390 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from JACYVU010000162.1. On Jan 5, 2022 this sequence version replaced XM_006238440.4. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: FQ210243.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA5756307, SAMEA5760400 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on conservation, expression, longest protein ##RefSeq-Attributes-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-550 JACYVU010000162.1 28252306-28252855 551-661 JACYVU010000162.1 28253410-28253520 662-776 JACYVU010000162.1 28254620-28254734 777-890 JACYVU010000162.1 28255755-28255868 891-986 JACYVU010000162.1 28256122-28256217 987-1253 JACYVU010000162.1 28258383-28258649 1254-1620 JACYVU010000162.1 28258977-28259343 FEATURES Location/Qualifiers source 1..1620 /organism="Rattus norvegicus" /mol_type="mRNA" /strain="BN" /db_xref="taxon:10116" /chromosome="5" /map="5q33" gene 1..1620 /gene="Angptl3" /note="angiopoietin-like 3" /db_xref="GeneID:502970" /db_xref="RGD:1564505" exon 1..550 /gene="Angptl3" /inference="alignment:Splign:2.1.0" misc_feature 38..40 /gene="Angptl3" /note="upstream in-frame stop codon" CDS 56..1423 /gene="Angptl3" /note="isoform 1 precursor is encoded by transcript variant 1; angiopoietin-related protein 3" /codon_start=1 /product="angiopoietin-related protein 3 isoform 1 precursor" /protein_id="NP_001386181.1" /db_xref="GeneID:502970" /db_xref="RGD:1564505" /translation="
MHTIKLLLFVVPLVISSRVDPDLSPFDSVPSEPKSRFAMLDDVKILANGLLQLGHGLKDFVHKTKGQINDIFQKLNIFDQCFYDLSLQTNEIKEEEKELRRTTSKLQVKNEEVKNMSLELNSKLESLLEEKMALQHRVRALEEQLTSLVQNPPGAREHPEVTSLKSFVEQQDNSIRELLQSVEEQYKQLSQQHIQIKEIENQLRKTGIQEPTENSLYSKPRAPRTTPPLHLKEAKNIEQDDLPADCSAIYNRGEHTSGVYTIRPSSSQVFNVYCDTQSGTPRTLIQHRKDGSQNFNQTWENYEKGFGRLDGEFWLGLEKIYAIVKQSNYILRLELQDWKDSKHYAEYSFHLGNHETNYTLHVAEIAANIPEALPEHRDLMFSTWDHRAKGQLYCPESYSGGWWFSDMCGENNLNGKYNKPRAKSKPERRRGISWRPRGGKLYSIKSSKMMLQPTT"
sig_peptide 56..103 /gene="Angptl3" /inference="COORDINATES: ab initio prediction:SignalP:4.0" misc_feature <323..>670 /gene="Angptl3" /note="Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning]; Region: Smc; COG1196" /db_xref="CDD:224117" misc_feature 776..1414 /gene="Angptl3" /note="Fibrinogen-related domains (FReDs); C terminal globular domain of fibrinogen. Fibrinogen is involved in blood clotting, being activated by thrombin to assemble into fibrin clots. The N-termini of 2 times 3 chains come together to form a globular...; Region: FReD; cd00087" /db_xref="CDD:238040" misc_feature 1130..1132 /gene="Angptl3" /note="gamma-gamma dimer interface [polypeptide binding]; other site" /db_xref="CDD:238040" misc_feature order(1214..1216,1220..1222,1226..1228) /gene="Angptl3" /note="Ca2+ binding site [ion binding]; other site" /db_xref="CDD:238040" misc_feature order(1235..1237,1244..1249,1277..1282) /gene="Angptl3" /note="polymerization pocket [active]" /db_xref="CDD:238040" exon 551..661 /gene="Angptl3" /inference="alignment:Splign:2.1.0" exon 662..776 /gene="Angptl3" /inference="alignment:Splign:2.1.0" exon 777..890 /gene="Angptl3" /inference="alignment:Splign:2.1.0" exon 891..986 /gene="Angptl3" /inference="alignment:Splign:2.1.0" exon 987..1253 /gene="Angptl3" /inference="alignment:Splign:2.1.0" exon 1254..1620 /gene="Angptl3" /inference="alignment:Splign:2.1.0" ORIGIN
tccttaccggaggaagacgttccaaattgcttgaaattgaataattgaaacaaaaatgcacacaattaagctgctcctttttgttgttcctctagtaatttcgtccagagttgatccagacctttcgccatttgattctgtaccgtcagagccaaaatcaagatttgctatgttggatgatgtcaaaattttagccaatggcctcctgcagctgggtcatggtcttaaagattttgtccataagacaaagggacaaattaatgacatatttcagaagctcaacatatttgatcagtgtttttatgacctatcacttcaaaccaatgaaatcaaagaagaggaaaaggagctaagaagaaccacatctaaactacaagttaaaaacgaagaggtgaagaatatgtcacttgaactgaactcaaagcttgaaagtctactggaggagaagatggcgctccaacacagagtcagggctttggaggaacagctgaccagcttggttcagaacccgcctggggctcgggagcacccagaggtaacgtcacttaaaagttttgtagaacagcaagataacagcataagagaactcctccagagtgtggaagaacaatataaacaactaagtcaacagcacattcagataaaagaaatagaaaatcagctcagaaagactggcattcaagaacccactgaaaattctctttattctaaaccaagagcaccaagaactactccccctcttcatctgaaggaagcaaaaaatatagaacaagatgatctgcctgctgactgctctgccatttataacagaggtgaacatacaagtggcgtgtatactattagaccaagcagctctcaagtgtttaatgtctactgtgacacccaatcaggcactccacggacattaattcaacaccggaaagatggctctcaaaacttcaaccaaacgtgggaaaactacgaaaagggttttgggaggcttgatggagaattctggttgggcctagagaagatctacgctatagtcaaacagtctaactacatcttacgactggagctacaagactggaaggacagcaagcactatgctgaatattcctttcatctgggcaatcatgaaaccaactacacgctacatgtggctgagattgctgccaatatccctgaggccctaccagaacacagagacctgatgttttctacatgggatcacagagcaaagggacagctctactgtccagaaagttattcaggtggctggtggttcagtgacatgtgtggagaaaacaacctaaatggtaaatacaacaaacccagagccaaatccaaaccagagcggagaagagggatctcctggaggcctcggggcggaaagctctactctatcaaatcatctaaaatgatgctccagccgaccacctaaggaagcgtcagctgaactgagacaaattaaaagaccaacacattcaatattaaaatccgcccgcacactgtagtacagcaatctggtattaaatctttagtggaaagcttaagaattgaatttcaattaactttaaagtcattgttaagatcagatatcattgcatcaatataacacaatttatattttcaatcaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]