LOCUS       NM_001191746            2459 bp    mRNA    linear   ROD 14-FEB-2025
DEFINITION  Rattus norvegicus distal-less homeobox 2 (Dlx2), mRNA.
ACCESSION   NM_001191746 XM_230986
VERSION     NM_001191746.2
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 2459)
  AUTHORS   Liu,Y.H., Tsai,J.W., Chen,J.L., Yang,W.S., Chang,P.C., Cheng,P.L.,
            Turner,D.L., Yanagawa,Y., Wang,T.W. and Yu,J.Y.
  TITLE     Ascl1 promotes tangential migration and confines migratory routes
            by induction of Ephb2 in the telencephalon
  JOURNAL   Sci Rep 7, 42895 (2017)
   PUBMED   28276447
  REMARK    GeneRIF: Results show that Dlx2 acted downstream of Ascl1 in
            promoting tangential migration along the ventricular
            zone/subventricular zone but not intermediate zone.
            Publication Status: Online-Only
REFERENCE   2  (bases 1 to 2459)
  AUTHORS   Wang,B., Long,J.E., Flandin,P., Pla,R., Waclaw,R.R., Campbell,K.
            and Rubenstein,J.L.
  TITLE     Loss of Gsx1 and Gsx2 function rescues distinct phenotypes in
            Dlx1/2 mutants
  JOURNAL   J Comp Neurol 521 (7), 1561-1584 (2013)
   PUBMED   23042297
  REMARK    Erratum:[J Comp Neurol. 2024 Feb;532(2):e25592. doi:
            10.1002/cne.25592.. PMID: 38362770]
REFERENCE   3  (bases 1 to 2459)
  AUTHORS   Delogu,A., Sellers,K., Zagoraiou,L., Bocianowska-Zbrog,A.,
            Mandal,S., Guimera,J., Rubenstein,J.L., Sugden,D., Jessell,T. and
            Lumsden,A.
  TITLE     Subcortical visual shell nuclei targeted by ipRGCs develop from a
            Sox14+-GABAergic progenitor and require Sox14 to regulate daily
            activity rhythms
  JOURNAL   Neuron 75 (4), 648-662 (2012)
   PUBMED   22920256
REFERENCE   4  (bases 1 to 2459)
  AUTHORS   Feng,L., Eisenstat,D.D., Chiba,S., Ishizaki,Y., Gan,L. and
            Shibasaki,K.
  TITLE     Brn-3b inhibits generation of amacrine cells by binding to and
            negatively regulating DLX1/2 in developing retina
  JOURNAL   Neuroscience 195, 9-20 (2011)
   PUBMED   21875655
REFERENCE   5  (bases 1 to 2459)
  AUTHORS   Jones,K.S. and Connor,B.
  TITLE     Proneural transcription factors Dlx2 and Pax6 are altered in adult
            SVZ neural precursor cells following striatal cell loss
  JOURNAL   Mol Cell Neurosci 47 (1), 53-60 (2011)
   PUBMED   21397028
  REMARK    GeneRIF: Results suggest Dlx2 and Pax6 may play a prominent role in
            directing neural precursor cell proliferation and neuroblast
            generation following striatal cell loss.
REFERENCE   6  (bases 1 to 2459)
  AUTHORS   Eisenstat,D.D., Liu,J.K., Mione,M., Zhong,W., Yu,G., Anderson,S.A.,
            Ghattas,I., Puelles,L. and Rubenstein,J.L.
  TITLE     DLX-1, DLX-2, and DLX-5 expression define distinct stages of basal
            forebrain differentiation
  JOURNAL   J Comp Neurol 414 (2), 217-237 (1999)
   PUBMED   10516593
REFERENCE   7  (bases 1 to 2459)
  AUTHORS   Liu,J.K., Ghattas,I., Liu,S., Chen,S. and Rubenstein,J.L.
  TITLE     Dlx genes encode DNA-binding proteins that are expressed in an
            overlapping and sequential pattern during basal ganglia
            differentiation
  JOURNAL   Dev Dyn 210 (4), 498-512 (1997)
   PUBMED   9415433
REFERENCE   8  (bases 1 to 2459)
  AUTHORS   Qiu,M., Bulfone,A., Ghattas,I., Meneses,J.J., Christensen,L.,
            Sharpe,P.T., Presley,R., Pedersen,R.A. and Rubenstein,J.L.
  TITLE     Role of the Dlx homeobox genes in proximodistal patterning of the
            branchial arches: mutations of Dlx-1, Dlx-2, and Dlx-1 and -2 alter
            morphogenesis of proximal skeletal and soft tissue structures
            derived from the first and second arches
  JOURNAL   Dev Biol 185 (2), 165-184 (1997)
   PUBMED   9187081
REFERENCE   9  (bases 1 to 2459)
  AUTHORS   Robel,L., Ding,M., James,A.J., Lin,X., Simeone,A., Leckman,J.F. and
            Vaccarino,F.M.
  TITLE     Fibroblast growth factor 2 increases Otx2 expression in precursor
            cells from mammalian telencephalon
  JOURNAL   J Neurosci 15 (12), 7879-7891 (1995)
   PUBMED   8613727
REFERENCE   10 (bases 1 to 2459)
  AUTHORS   Qiu,M., Bulfone,A., Martinez,S., Meneses,J.J., Shimamura,K.,
            Pedersen,R.A. and Rubenstein,J.L.
  TITLE     Null mutation of Dlx-2 results in abnormal morphogenesis of
            proximal first and second branchial arch derivatives and abnormal
            differentiation in the forebrain
  JOURNAL   Genes Dev 9 (20), 2523-2538 (1995)
   PUBMED   7590232
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            JAXUCZ010000003.1.
            
            On Oct 27, 2022 this sequence version replaced NM_001191746.1.
            
            Sequence Note:.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            RNAseq introns :: single sample supports all introns SAMEA5760393
                              [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-760               JAXUCZ010000003.1  76780496-76781255   c
            761-945             JAXUCZ010000003.1  76779907-76780091   c
            946-2459            JAXUCZ010000003.1  76777912-76779425   c
FEATURES             Location/Qualifiers
     source          1..2459
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /strain="BN"
                     /db_xref="taxon:10116"
                     /chromosome="3"
                     /map="3q23"
     gene            1..2459
                     /gene="Dlx2"
                     /gene_synonym="DLX-5; Dlx5"
                     /note="distal-less homeobox 2"
                     /db_xref="GeneID:296499"
                     /db_xref="RGD:1304853"
     exon            1..760
                     /gene="Dlx2"
                     /gene_synonym="DLX-5; Dlx5"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    202..204
                     /gene="Dlx2"
                     /gene_synonym="DLX-5; Dlx5"
                     /note="upstream in-frame stop codon"
     CDS             352..1350
                     /gene="Dlx2"
                     /gene_synonym="DLX-5; Dlx5"
                     /note="homeobox Dlx5"
                     /codon_start=1
                     /product="homeobox protein DLX-2"
                     /protein_id="NP_001178675.1"
                     /db_xref="GeneID:296499"
                     /db_xref="RGD:1304853"
                     /translation="

MTGVFDSLVADMHSTQITASSTYHQHQQPPSGAGAGSGGSSNSSSSNSNLHKPQESPTLPVSTATDSSYYTNQQHPAGGGGGGASPYAHMGSYQYHASGLNNVSYSAKSSYDLGYTAAYTSYAPYGTSSSPVNNEPDKEDLEPEIRIVNGKPKKVRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVKIWFQNRRSKFKKMWKSGEIPTEQHPGASASPPCASPPVSAPASWDFGAQQRMAGGGPGSGGSGAGSSGSSPSSAASAFLGNYPWYHQASGSASHLQATAPLLHPSQTPQAHHHHHHHHHAGGGAPVSAGTIF"

     misc_feature    511..756
                     /gene="Dlx2"
                     /gene_synonym="DLX-5; Dlx5"
                     /note="Homeobox protein distal-less-like N terminal;
                     Region: DLL_N; pfam12413"
                     /db_xref="CDD:463567"
     misc_feature    817..987
                     /gene="Dlx2"
                     /gene_synonym="DLX-5; Dlx5"
                     /note="Region: Homeodomain; pfam00046"
                     /db_xref="CDD:459649"
     exon            761..945
                     /gene="Dlx2"
                     /gene_synonym="DLX-5; Dlx5"
                     /inference="alignment:Splign:2.1.0"
     exon            946..2459
                     /gene="Dlx2"
                     /gene_synonym="DLX-5; Dlx5"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

agacaatcgtaaagctgctcgggggtcgctcacctgctcccgccttctggagcccctaccgggcctgaccgctcttgccccctccgttgcccgccccccgcccgagccgggccaggagccgagaggccggggaaggatgcagccagcagctgcggtcccgagccacgcacggtgatcgcctcctccaggggaggaggcgcctagaccgtagcctcatttcttgttttcctctccctcccccctccccgtaattacattggctgctggaagggacctggagaaatagacggaggaggcgccttgcaaccccctctcgcccgccacccgtgctctttcctgtcccgggtcaggatgactggagtctttgacagtctggtggctgatatgcactcgacccagatcacagcctccagcacgtaccaccagcaccagcagcccccgagcggtgcgggcgcgggctctggcggcagcagcaacagcagcagcagcaacagcaacctgcacaagccccaggagtcgccaaccctgccggtgtccacggctaccgacagcagctactacaccaaccagcagcacccggcgggtggcggcggcgggggggcctcgccctacgcgcacatgggctcctaccagtaccacgccagcggcctcaacaacgtctcctactccgccaaaagcagctacgacctgggctacaccgccgcgtacacttcctacgcgccctacggaaccagttcgtccccagtcaacaacgagcccgacaaggaagaccttgagcctgaaatccgaattgtgaacgggaagccaaagaaagtccggaaaccacgcaccatctactccagtttccagctggccgcccttcagcgacgcttccagaagacccagtatctggccctgcctgagcgagccgagctggcggcctccctgggccttacccaaactcaggtcaaaatctggttccagaaccgccgatccaagttcaagaagatgtggaagagtggcgagatccccacagagcagcaccctggagccagcgcttccccaccatgtgcctccccgccggtttcggcgccagcatcctgggacttcggcgcgcaacagcggatggcgggcggcggcccaggcagcggaggcagcggcgcgggcagctccggctccagcccgagcagcgccgcctcggcttttctgggaaactacccgtggtaccaccaggcttcgggctccgcttcacacctgcaggccactgcgccacttctgcatccctcgcagactccgcaggcgcaccaccaccaccaccatcaccaccacgcaggcgggggcgccccggtgagcgccgggacgattttctaaccctgagcgatcagcgccagagacttgagaactgagacaccgtgttcttcagcacgcgtaccgtagctagaggctcaaacctaccagcccgcgaccgccacccagccgtattggaagtgacaaccaggggtggcccgtctcggagccactcctcgcactgccacggagcagccgggaacaaggaggcctcgtgggatcctctagtgccaagcccggcatccctggcctcaattccgacctgagccccggccacttctaggccgtcctcggacttgtcgcccggtctcagcctcctcattgtaatcctcagggtccttggtctctccaggccctgagctgggtcaggcacagggacgccttccctgccctcgaggcttcccggctctcagaggctcctttttcctctcctgccccaggcctcagctccagtccgcttcggttattgacctccctgggtcctaccccatcccatcacgtacccccttgacccccgggatcccgccggtttcccccccccctcctgggggctcatgaggagaattcccagctctcccaactcttcccacctcccgctttccccaggaacactcccttagctcctcgtccatcaccagtggagtttttttatttttatttttttaaaagtttaggtgcctttgcggatgacctcattttgatgttgaaaaaatgatttttttaatatgtggacgctgcaaaaaatgtgtttaaattatcttttttaagatgaattaaggactattagcccgaacttcgacgcagagtttgtaaataagggtgtctgtgcagatttccccacatttatttgtataaaatttctcatcttttcagacatttttgtaaaccgccccccagttgtgaaagctgcgacgtagcaatgacctcagcagcccctatgttttccccctttgaaaatttttctcagttaaattaagctactgatttgaatttgttttttatcttgtcctaaaaaatctttgttcttgaaatgcaaggtatttgggggttatttattatgaaagcaacatactcttaatgttgattttacaatatgaagagattatttaaaataaattattgttttcattgga

//