LOCUS       NM_001127653            1468 bp    mRNA    linear   ROD 20-MAR-2023
DEFINITION  Rattus norvegicus NK2 homeobox 6 (Nkx2-6), mRNA.
ACCESSION   NM_001127653 XM_001068954 XM_344429
VERSION     NM_001127653.1
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 1468)
  AUTHORS   Wang J, Mao JH, Ding KK, Xu WJ, Liu XY, Qiu XB, Li RG, Qu XK, Xu
            YJ, Huang RT, Xue S and Yang YQ.
  TITLE     A novel NKX2.6 mutation associated with congenital ventricular
            septal defect
  JOURNAL   Pediatr Cardiol 36 (3), 646-656 (2015)
   PUBMED   25380965
REFERENCE   2  (bases 1 to 1468)
  AUTHORS   Wang J, Zhang DF, Sun YM, Li RG, Qiu XB, Qu XK, Liu X, Fang WY and
            Yang YQ.
  TITLE     NKX2-6 mutation predisposes to familial atrial fibrillation
  JOURNAL   Int J Mol Med 34 (6), 1581-1590 (2014)
   PUBMED   25319568
REFERENCE   3  (bases 1 to 1468)
  AUTHORS   Heathcote K, Braybrook C, Abushaban L, Guy M, Khetyar ME, Patton
            MA, Carter ND, Scambler PJ and Syrris P.
  TITLE     Common arterial trunk associated with a homeodomain mutation of
            NKX2.6
  JOURNAL   Hum Mol Genet 14 (5), 585-593 (2005)
   PUBMED   15649947
REFERENCE   4  (bases 1 to 1468)
  AUTHORS   Tanaka M, Schinke M, Liao HS, Yamasaki N and Izumo S.
  TITLE     Nkx2.5 and Nkx2.6, homologs of Drosophila tinman, are required for
            development of the pharynx
  JOURNAL   Mol Cell Biol 21 (13), 4391-4398 (2001)
   PUBMED   11390666
REFERENCE   5  (bases 1 to 1468)
  AUTHORS   Biben C, Hatzistavrou T and Harvey RP.
  TITLE     Expression of NK-2 class homeobox gene Nkx2-6 in foregut endoderm
            and heart
  JOURNAL   Mech Dev 73 (1), 125-127 (1998)
   PUBMED   9545560
REFERENCE   6  (bases 1 to 1468)
  AUTHORS   Tanaka M, Kasahara H, Bartunkova S, Schinke M, Komuro I, Inagaki H,
            Lee Y, Lyons GE and Izumo S.
  TITLE     Vertebrate homologs of tinman and bagpipe: roles of the homeobox
            genes in cardiovascular development
  JOURNAL   Dev Genet 22 (3), 239-249 (1998)
   PUBMED   9621431
REFERENCE   7  (bases 1 to 1468)
  AUTHORS   Nikolova M, Chen X and Lufkin T.
  TITLE     Nkx2.6 expression is transiently and specifically restricted to the
            branchial region of pharyngeal-stage mouse embryos
  JOURNAL   Mech Dev 69 (1-2), 215-218 (1997)
   PUBMED   9486544
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from BC160896.1.
            
            On or before May 25, 2008 this sequence version replaced
            XM_344429.3, XM_001068954.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC160896.1, CK598451.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA5760383, SAMEA5760389
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..1468
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /db_xref="taxon:10116"
                     /chromosome="15"
                     /map="15p11"
     gene            1..1468
                     /gene="Nkx2-6"
                     /note="NK2 homeobox 6"
                     /db_xref="GeneID:364418"
                     /db_xref="RGD:1306149"
     exon            1..70
                     /gene="Nkx2-6"
                     /inference="alignment:Splign:2.1.0"
     CDS             43..684
                     /gene="Nkx2-6"
                     /codon_start=1
                     /product="homeobox protein Nkx-2.6"
                     /protein_id="NP_001121125.1"
                     /db_xref="GeneID:364418"
                     /db_xref="RGD:1306149"
                     /translation="

MDSNLVREPKTPPGTISPLGVENLMMEHGVGNRSDDPRRAGPVPTVTRPRRKPRVLFSQAQVLALERRFKQQRYLSAPEREHLASVLQLTSTQVKIWFQNRRYKCKRQRQDQTLELAGHPLAPRRVAVPVLVLDVKPCLDPDRHAFPSPYATTVLYSCFSSYTGTPYSASYAGRYTGAGPGPLAPLASSGFSPGGQSAAPQGHLAATPQGVTA"

     misc_feature    193..363
                     /gene="Nkx2-6"
                     /note="Region: Homeodomain; pfam00046"
                     /db_xref="CDD:459649"
     exon            71..1443
                     /gene="Nkx2-6"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

gaagcaaccccttttctgtgcacctgggagacagtcctagagatggactcaaatcttgtgagggagccgaagactcccccgggcacaatctccccacttggagtcgagaacctgatgatggagcatggcgtgggcaaccggagcgacgacccgcgccgagctggccctgttccgaccgtgacccggccacggcggaagccccgcgtgctattttcgcaggcccaggtgctggccctggagcggcgcttcaagcagcagcgatacctgtctgcgccggagcgtgagcacttggccagtgtgctgcagctcacgtccacgcaggtcaagatctggttccaaaaccggcgctacaagtgcaagagacagcgccaggaccagaccctggaactggcgggccacccactagcaccgcgccgggtggcagtgcccgtacttgtactggacgtcaagccctgcctagatcccgacagacacgcattcccgagtccctacgcaaccaccgtgctctactcctgcttcagcagctacacaggcactccctacagcgctagctatgcgggccgctacaccggcgccggcccggggccacttgcaccgctggctagctctggcttcagcccaggtggccaaagtgcggccccgcagggccatttggccgctacgccacagggagtcacggcctagtgaaaaacctgggctcacctaccgacatcaggtgcctgatgcctgatgcctgatcccctccccttccacctgctcgccgcttggctggaaagccgcgatgggtctgcactgccggtcgtactgatctcgaaatgaactgtccggaggagcggcccctgcagaccttgagaacattctttccctcggagaagtaaccgtgctttggccagccacatagatgctgtgcagagagaatagcacagtggtggttgatagtttgggggcaggtgattctaaactacaattccttctaaactaatgcaacggcctcccttccaccccttaaaggaacgagccgagccggggttgaggggatgcgggggggggggggttgagagaaaaaggccagaccgttgagactgaccaaggaagtgccagacaggatttttattgccacccactctctgcaatgggtttaagcatagggacctttggaaacatccacaggctagcacttcccctggctgtgatcttgctttcaaaaggggcctcttcatttctccagtcaccttaactgcattttatgtagggaacagccagaccagtaaatgagctattcagtgtgcttgcgtgttagagccgccaagaccctcaagaagttctgttattctcaggagacccacacgggagaactggggagttggaggccaatctgcactaagtaaagaaaccctgcctgtatctaaagcaaaataaaatagacctagggagataaaaccaaaaaaaaaaaaaaaaaaaaaaaaaa

//