GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-04-28 18:16:48, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_001108880            1372 bp    mRNA    linear   ROD 20-MAR-2023
DEFINITION  Rattus norvegicus BARX homeobox 1 (Barx1), mRNA.
ACCESSION   NM_001108880 XM_001056986 XM_344575
VERSION     NM_001108880.1
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 1372)
  AUTHORS   Verzi MP, Stanfel MN, Moses KA, Kim BM, Zhang Y, Schwartz RJ,
            Shivdasani RA and Zimmer WE.
  TITLE     Role of the homeodomain transcription factor Bapx1 in mouse distal
            stomach development
  JOURNAL   Gastroenterology 136 (5), 1701-1710 (2009)
   PUBMED   19208343
REFERENCE   2  (bases 1 to 1372)
  AUTHORS   Kim BM, Miletich I, Mao J, McMahon AP, Sharpe PA and Shivdasani RA.
  TITLE     Independent functions and mechanisms for homeobox gene Barx1 in
            patterning mouse stomach and spleen
  JOURNAL   Development 134 (20), 3603-3613 (2007)
   PUBMED   17855428
REFERENCE   3  (bases 1 to 1372)
  AUTHORS   Kim BM, Buchner G, Miletich I, Sharpe PT and Shivdasani RA.
  TITLE     The stomach mesenchymal transcription factor Barx1 specifies
            gastric epithelial identity through inhibition of transient Wnt
            signaling
  JOURNAL   Dev Cell 8 (4), 611-622 (2005)
   PUBMED   15809042
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from CH473977.1.
            
            On or before Oct 4, 2007 this sequence version replaced
            XM_344575.3, XM_001056986.1.
            
            ##Evidence-Data-START##
            RNAseq introns :: single sample supports all introns SAMEA5756307,
                              SAMN12840105 [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..1372
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /db_xref="taxon:10116"
                     /chromosome="17"
                     /map="17p14"
     gene            1..1372
                     /gene="Barx1"
                     /note="BARX homeobox 1"
                     /db_xref="GeneID:364680"
                     /db_xref="RGD:1310884"
     exon            1..306
                     /gene="Barx1"
                     /inference="alignment:Splign:2.1.0"
     CDS             84..848
                     /gene="Barx1"
                     /note="BarH-like homeobox 1"
                     /codon_start=1
                     /product="homeobox protein BarH-like 1"
                     /protein_id="NP_001102350.1"
                     /db_xref="GeneID:364680"
                     /db_xref="RGD:1310884"
                     /translation="
MQRPGEPGSARFGPPEGCADHRPHRYRSFMIEEILTEPPGPKGAAPAAAAAAAGELLKFGVQALLAARPFHSHLAVLKAEQAAVFKFPLAPLGCSGLGSALLAAGPGMPGTAGTSHLPLELQLRGKLEAAGSGEPGTKAKKGRRSRTVFTELQLMGLEKRFEKQKYLSTPDRIDLAESLGLSQLQVKTWYQNRRMKWKKIVLQGGGLESPTKPKGRPKKNSIPTSEQLTEQERAKEAEKPAETPGEPSDRSCED"
     misc_feature    order(510..524,528..530,579..581,597..599,636..638,
                     642..647,654..659,663..671,675..680)
                     /gene="Barx1"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    516..677
                     /gene="Barx1"
                     /note="Homeobox domain; Region: Homeobox; pfam00046"
                     /db_xref="CDD:425441"
     misc_feature    order(516..518,525..527,645..647,654..659,666..668)
                     /gene="Barx1"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     exon            307..598
                     /gene="Barx1"
                     /inference="alignment:Splign:2.1.0"
     exon            599..683
                     /gene="Barx1"
                     /inference="alignment:Splign:2.1.0"
     exon            684..1372
                     /gene="Barx1"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
ccggcctagagccccgcgcgggccccgcgccaaagcttagccgccgtcgctgcctagccgtggtcgcatccccgggagccgcgatgcagcggccgggggagccgggctccgcgcgcttcggtccgcccgagggctgtgcggatcatcgaccgcatcgctaccgcagcttcatgatcgaagagatcctcaccgagcctcccgggcccaagggcgcagcgcccgcggccgccgctgctgccgcgggcgagctgctcaagttcggcgtgcaggcgctgctggccgcccggcccttccacagccacctggcggtgctgaaggctgagcaggccgcagtgttcaagttcccactggcgccgctcggctgctctgggctgggctccgccttgttggccgcggggcctgggatgcccggcaccgcaggcacgtcgcacctgccactggagctgcaactccgcgggaagctggaagccgctggctcgggggaacctggcacgaaagccaagaaaggacgccggagccgcactgtattcactgagctgcagctgatgggtctggagaaacgcttcgagaagcagaagtacctctctaccccagacagaatagatctagctgaatccctgggcctgagccagttacaggtgaagacgtggtatcaaaatcggaggatgaaatggaagaaaatagtgctgcagggtggaggcctggagtcccccaccaagcccaagggacggcccaagaagaactccatccccacgagcgagcagctcacggagcaggagcgcgccaaggaggcagagaagccagcggagacaccgggcgagcccagcgatcgaagctgcgaggactgagcgtcgcggagggtgcggcgccttcagcggcgaccccaggagctggccctttcgtgctcaagccgtttgctttctaaacgtttcattactactttgaatgcggacagttacgggccagacaaggaaggacacaggcccggaagccaatcccaggtctcagcgagctcctgcccccagtctgggagagttgtgttcagcgtggccgaagcttctggtctttctcggacctccgcagtgccccggcgctccacgcgcattcacgtcccgctccttgcccacacttttccccggcctccagccggccttctgggcccggacaccggcaggcacacactcgtttctgcgccttggggacccggccgccaggtgcaggtccctaccaccctgccctgcagaatcgtctctagcaaatcagctgacacctggtacccgatgtcgctgaggcttctaacccctctcttgcaaagacggtgacttttttttttccaataaaatattttatgacacagtgggggggcttgatg
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]