GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-11-22 23:45:15, GGRNA.v2 : RefSeq release 226 (Sep, 2024)

LOCUS       NM_001108644             881 bp    mRNA    linear   ROD 24-JUN-2024
DEFINITION  Rattus norvegicus microfibril associated protein 5 (Mfap5), mRNA.
ACCESSION   NM_001108644 XM_001060323 XM_342750
VERSION     NM_001108644.1
KEYWORDS    RefSeq.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 881)
  AUTHORS   Hofling,C., Rossner,S., Flachmeyer,B., Krueger,M., Hartig,W. and
            Michalski,D.
  TITLE     Tricellulin, alpha-Catenin and Microfibrillar-Associated Protein 5
            Exhibit Concomitantly Altered Immunosignals along with Vascular,
            Extracellular and Cytoskeletal Elements after Experimental Focal
            Cerebral Ischemia
  JOURNAL   Int J Mol Sci 24 (15), 11893 (2023)
   PUBMED   37569268
  REMARK    GeneRIF: Tricellulin, alpha-Catenin and Microfibrillar-Associated
            Protein 5 Exhibit Concomitantly Altered Immunosignals along with
            Vascular, Extracellular and Cytoskeletal Elements after
            Experimental Focal Cerebral Ischemia.
            Publication Status: Online-Only
REFERENCE   2  (bases 1 to 881)
  AUTHORS   Barallobre-Barreiro,J., Oklu,R., Lynch,M., Fava,M., Baig,F.,
            Yin,X., Barwari,T., Potier,D.N., Albadawi,H., Jahangiri,M.,
            Porter,K.E., Watkins,M.T., Misra,S., Stoughton,J. and Mayr,M.
  TITLE     Extracellular matrix remodelling in response to venous
            hypertension: proteomics of human varicose veins
  JOURNAL   Cardiovasc Res 110 (3), 419-430 (2016)
   PUBMED   27068509
REFERENCE   3  (bases 1 to 881)
  AUTHORS   Abonnenc,M., Nabeebaccus,A.A., Mayr,U., Barallobre-Barreiro,J.,
            Dong,X., Cuello,F., Sur,S., Drozdov,I., Langley,S.R., Lu,R.,
            Stathopoulou,K., Didangelos,A., Yin,X., Zimmermann,W.H., Shah,A.M.,
            Zampetaki,A. and Mayr,M.
  TITLE     Extracellular matrix secretion by cardiac fibroblasts: role of
            microRNA-29b and microRNA-30c
  JOURNAL   Circ Res 113 (10), 1138-1147 (2013)
   PUBMED   24006456
REFERENCE   4  (bases 1 to 881)
  AUTHORS   Combs,M.D., Knutsen,R.H., Broekelmann,T.J., Toennies,H.M.,
            Brett,T.J., Miller,C.A., Kober,D.L., Craft,C.S., Atkinson,J.J.,
            Shipley,J.M., Trask,B.C. and Mecham,R.P.
  TITLE     Microfibril-associated glycoprotein 2 (MAGP2) loss of function has
            pleiotropic effects in vivo
  JOURNAL   J Biol Chem 288 (40), 28869-28880 (2013)
   PUBMED   23963447
REFERENCE   5  (bases 1 to 881)
  AUTHORS   Lemaire,R., Bayle,J., Mecham,R.P. and Lafyatis,R.
  TITLE     Microfibril-associated MAGP-2 stimulates elastic fiber assembly
  JOURNAL   J Biol Chem 282 (1), 800-808 (2007)
   PUBMED   17099216
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from CH473964.2.
            
            On or before Oct 4, 2007 this sequence version replaced
            XM_342750.3, XM_001060323.1.
            
            ##Evidence-Data-START##
            CDS exon combination :: FQ229611.1, FM103833.1 [ECO:0000331]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..881
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /db_xref="taxon:10116"
                     /chromosome="4"
                     /map="4q42"
     gene            1..881
                     /gene="Mfap5"
                     /note="microfibril associated protein 5"
                     /db_xref="GeneID:362429"
                     /db_xref="RGD:1307919"
     exon            1..89
                     /gene="Mfap5"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    76..78
                     /gene="Mfap5"
                     /note="upstream in-frame stop codon"
     exon            90..145
                     /gene="Mfap5"
                     /inference="alignment:Splign:2.1.0"
     exon            146..205
                     /gene="Mfap5"
                     /inference="alignment:Splign:2.1.0"
     CDS             148..648
                     /gene="Mfap5"
                     /note="microfibrillar associated protein 5"
                     /codon_start=1
                     /product="microfibrillar-associated protein 5 precursor"
                     /protein_id="NP_001102114.1"
                     /db_xref="GeneID:362429"
                     /db_xref="RGD:1307919"
                     /translation="
MLVFGQKALLLVVALSIPSDWLPLGVSGQRGDDVPETFTDDPNLVNDPSTDDTVLADITPSTDDLASAGDKNTTAECRDEKFACTRLYSVHRPVRQCVHQACFTSLRRMYIINNEICSRLVCKEHEAMKDELCRQMAGLPPRRLRRSNYFRLPPCENMNLQRPDGP"
     sig_peptide     148..231
                     /gene="Mfap5"
                     /inference="COORDINATES: ab initio prediction:SignalP:6.0"
     misc_feature    151..555
                     /gene="Mfap5"
                     /note="Microfibril-associated glycoprotein (MAGP); Region:
                     MAGP; pfam05507"
                     /db_xref="CDD:461667"
     exon            206..241
                     /gene="Mfap5"
                     /inference="alignment:Splign:2.1.0"
     exon            242..274
                     /gene="Mfap5"
                     /inference="alignment:Splign:2.1.0"
     exon            275..307
                     /gene="Mfap5"
                     /inference="alignment:Splign:2.1.0"
     exon            308..343
                     /gene="Mfap5"
                     /inference="alignment:Splign:2.1.0"
     exon            344..373
                     /gene="Mfap5"
                     /inference="alignment:Splign:2.1.0"
     exon            374..461
                     /gene="Mfap5"
                     /inference="alignment:Splign:2.1.0"
     exon            462..535
                     /gene="Mfap5"
                     /inference="alignment:Splign:2.1.0"
     exon            536..881
                     /gene="Mfap5"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
agatttccaggtgcaagaagacaaggttgccccagagaagcagtcgcatcaaggtgagccagccccctaagtcactaagacagactgcagacagacacactcggcagccagaggccacggcggacagagcacagcgctgtagacaatatgctggtctttgggcagaaggccttgctgcttgtcgtggcactcagcatcccctccgactggctacccctaggggtcagtggccaacgaggagatgacgtacccgagacattcacagatgaccctaatctggtgaatgatccttctacagacgatacagttctggcggatatcacaccttccacggatgacctggcctcagctggtgacaaaaatactactgcagagtgccgggatgagaagtttgcttgtacaagactgtactctgtccatcggcccgtcagacagtgtgtgcaccaggcctgcttcaccagtttacgtcgcatgtacatcatcaataatgagatctgttcccggcttgtctgtaaagaacacgaggccatgaaagatgagctttgccggcagatggcaggcctgcctccaaggcgactccgccgctccaactacttccgacttcctccctgtgaaaatatgaacttacagagacccgatggtccgtgatcaccaaggaagaacgaagaaagtgtggatgagggaatccgaaattccttctactccaaccgctgccatctgtcccgtagacgtgtatttttaaactaagccctttgcaatgtcccggcttcctaccctactctgtaattttcactggaactggtaacgtttgtctcgtttcgcaatacagtgtctccattgttgtacgggctcgctgatatctggtatgggagacaaggtgg
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]