GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2026-05-14 03:17:54, GGRNA.v2 : RefSeq release 233 (Jan, 2026)

LOCUS       NM_001107834            2318 bp    mRNA    linear   ROD 23-MAR-2023
DEFINITION  Rattus norvegicus PBX homeobox 3 (Pbx3), mRNA.
ACCESSION   NM_001107834 XM_001078717 XM_001078726 XM_001078743 XM_001078759
            XM_231158
VERSION     NM_001107834.1
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 2318)
  AUTHORS   Han Y, Dong B, Chen M and Yao C.
  TITLE     LncRNA H19 suppresses pyroptosis of cardiomyocytes to attenuate
            myocardial infarction in a PBX3/CYP1B1-dependent manner
  JOURNAL   Mol Cell Biochem 476 (3), 1387-1400 (2021)
   PUBMED   33389498
  REMARK    GeneRIF: LncRNA H19 suppresses pyroptosis of cardiomyocytes to
            attenuate myocardial infarction in a PBX3/CYP1B1-dependent manner.
REFERENCE   2  (bases 1 to 2318)
  AUTHORS   Wang D, You D, Pan Y and Liu P.
  TITLE     Downregulation of lncRNA-HEIH curbs esophageal squamous cell
            carcinoma progression by modulating miR-4458/PBX3
  JOURNAL   Thorac Cancer 11 (7), 1963-1971 (2020)
   PUBMED   32449803
REFERENCE   3  (bases 1 to 2318)
  AUTHORS   Arrington CB, Dowse BR, Bleyl SB and Bowles NE.
  TITLE     Non-synonymous variants in pre-B cell leukemia homeobox (PBX) genes
            are associated with congenital heart defects
  JOURNAL   Eur J Med Genet 55 (4), 235-237 (2012)
   PUBMED   22426282
REFERENCE   4  (bases 1 to 2318)
  AUTHORS   Rottkamp CA, Lobur KJ, Wladyka CL, Lucky AK and O'Gorman S.
  TITLE     Pbx3 is required for normal locomotion and dorsal horn development
  JOURNAL   Dev Biol 314 (1), 23-39 (2008)
   PUBMED   18155191
REFERENCE   5  (bases 1 to 2318)
  AUTHORS   Ferretti E, Villaescusa JC, Di Rosa P, Fernandez-Diaz LC,
            Longobardi E, Mazzieri R, Miccio A, Micali N, Selleri L, Ferrari G
            and Blasi F.
  TITLE     Hypomorphic mutation of the TALE gene Prep1 (pKnox1) causes a major
            reduction of Pbx and Meis proteins and a pleiotropic embryonic
            phenotype
  JOURNAL   Mol Cell Biol 26 (15), 5650-5662 (2006)
   PUBMED   16847320
REFERENCE   6  (bases 1 to 2318)
  AUTHORS   Onimaru H, Arata A, Arata S, Shirasawa S and Cleary ML.
  TITLE     In vitro visualization of respiratory neuron activity in the
            newborn mouse ventral medulla
  JOURNAL   Brain Res Dev Brain Res 153 (2), 275-279 (2004)
   PUBMED   15527896
REFERENCE   7  (bases 1 to 2318)
  AUTHORS   Rhee JW, Arata A, Selleri L, Jacobs Y, Arata S, Onimaru H and
            Cleary ML.
  TITLE     Pbx3 deficiency results in central hypoventilation
  JOURNAL   Am J Pathol 165 (4), 1343-1350 (2004)
   PUBMED   15466398
REFERENCE   8  (bases 1 to 2318)
  AUTHORS   Toresson H, Parmar M and Campbell K.
  TITLE     Expression of Meis and Pbx genes and their protein products in the
            developing telencephalon: implications for regional differentiation
  JOURNAL   Mech Dev 94 (1-2), 183-187 (2000)
   PUBMED   10842069
REFERENCE   9  (bases 1 to 2318)
  AUTHORS   Ferretti E, Schulz H, Talarico D, Blasi F and Berthelsen J.
  TITLE     The PBX-regulating protein PREP1 is present in different
            PBX-complexed forms in mouse
  JOURNAL   Mech Dev 83 (1-2), 53-64 (1999)
   PUBMED   10381567
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from CH474001.2.
            
            On or before Oct 4, 2007 this sequence version replaced
            XM_231158.4, XM_001078726.1, XM_001078759.1, XM_001078717.1,
            XM_001078743.1.
            
            ##Evidence-Data-START##
            RNAseq introns :: single sample supports all introns SAMEA5760389,
                              SAMEA5760433 [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on conservation, expression,
                                      longest protein
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..2318
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /db_xref="taxon:10116"
                     /chromosome="3"
                     /map="3p11"
     gene            1..2318
                     /gene="Pbx3"
                     /note="PBX homeobox 3"
                     /db_xref="GeneID:311876"
                     /db_xref="RGD:1307198"
     exon            1..245
                     /gene="Pbx3"
                     /inference="alignment:Splign:2.1.0"
     CDS             46..1350
                     /gene="Pbx3"
                     /note="pre-B-cell leukemia homeobox 3; pre-B-cell leukemia
                     transcription factor 3-like"
                     /codon_start=1
                     /product="pre-B-cell leukemia transcription factor 3"
                     /protein_id="NP_001101304.1"
                     /db_xref="GeneID:311876"
                     /db_xref="RGD:1307198"
                     /translation="
MDDQSRMLQTLAGVNLAGHSVQGGMALPPPPHGHEGADGDGRKQDIGDILHQIMTITDQSLDEAQAKKHALNCHRMKPALFSVLCEIKEKTGLSIRGAQEEDPPDPQLMRLDNMLLAEGVSGPEKGGGSAAAAAAAAASGGSSDNSIEHSDYRAKLTQIRQIYHTELEKYEQACNEFTTHVMNLLREQSRTRPISPKEIERMVGIIHRKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNFSKQATEILNEYFYSHLSNPYPSEEAKEELAKKCSITVSQVSNWFGNKRIRYKKNIGKFQEEANLYAAKTAVTAAHAVAAAVQNNQTNSPTTPNSGSSGSFNLPNSGDMFMNMQSLNGDSYQGSQVGANVQSQVDTLRHVINQTGGYSDGLGANSLYSPHNLNANGGWQDATTPSSVTSPTEGPGSVHSDTSN"
     misc_feature    178..747
                     /gene="Pbx3"
                     /note="PBC domain; Region: PBC; pfam03792"
                     /db_xref="CDD:461052"
     misc_feature    751..933
                     /gene="Pbx3"
                     /note="Homeodomain; DNA binding domains involved in the
                     transcriptional regulation of key eukaryotic developmental
                     processes; may bind to DNA as monomers or as homo- and/or
                     heterodimers, in a sequence-specific manner; Region:
                     homeodomain; cd00086"
                     /db_xref="CDD:238039"
     misc_feature    order(751..765,769..771,829..831,847..849,886..888,
                     892..897,904..909,913..921,925..930)
                     /gene="Pbx3"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    order(757..759,766..768,895..897,904..909,916..918)
                     /gene="Pbx3"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     exon            246..319
                     /gene="Pbx3"
                     /inference="alignment:Splign:2.1.0"
     exon            320..561
                     /gene="Pbx3"
                     /inference="alignment:Splign:2.1.0"
     exon            562..752
                     /gene="Pbx3"
                     /inference="alignment:Splign:2.1.0"
     exon            753..888
                     /gene="Pbx3"
                     /inference="alignment:Splign:2.1.0"
     exon            889..1054
                     /gene="Pbx3"
                     /inference="alignment:Splign:2.1.0"
     exon            1055..1167
                     /gene="Pbx3"
                     /inference="alignment:Splign:2.1.0"
     exon            1168..1257
                     /gene="Pbx3"
                     /inference="alignment:Splign:2.1.0"
     exon            1258..2318
                     /gene="Pbx3"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
cttcgcctccgccgccgccgcccgctcccgcccgcgcgcggcgggatggacgatcaatccaggatgctgcagactctggccggggtgaacctggccggccactcggtccaagggggtatggctctgccgcctccccctcacggccacgaaggggcggacggcgacggcaggaagcaggacatcggcgacatcctccaccagatcatgaccatcaccgaccagagcttggacgaggcgcaagcaaagaaacatgctctgaactgtcacagaatgaaaccggcgctcttcagcgtcttgtgtgagatcaaagagaaaacaggtctcagcatcagaggagcccaggaggaagaccctcccgacccccagctaatgagactggacaatatgcttttggcagaaggggtttcaggtcctgagaaaggtgggggatcggcggcagcagctgcagccgcggcagcctctggaggttcttcagataactctattgaacactcagattacagagccaaattgacccagatcagacaaatctatcacacagaactggagaaatatgaacaggcatgtaatgaattcacaacacacgtgatgaaccttctccgagaacagagtagaacgcgtcccatttccccgaaagagatcgaaaggatggtgggcatcatccacaggaagtttagctccatccaaatgcagctcaagcagagcacgtgtgaagcagtcatgattttaagatcaaggttccttgatgccagacggaaaaggcgtaacttcagtaaacaggctacagaaatcttgaatgaatatttttactcacacctcagcaacccctaccccagtgaagaagccaaagaggagctggccaagaaatgcagcatcacagtatcacaggtatccaactggtttggcaacaaacgaatcaggtacaagaagaacatcggcaaatttcaagaggaggccaatctctatgctgcaaaaacagccgtgacagccgcacacgcagtggccgcagccgtgcagaacaaccagaccaactcacccaccacgccaaactctggttcttctggttcttttaacctcccaaattctggggacatgttcatgaacatgcagagtctgaatggggattcttaccaagggtcccaagtcggagccaatgtgcagtcacaggtggataccctccgtcatgttatcaatcagacgggaggctacagtgacggccttggagcaaactcactgtacagtccgcataacttaaacgctaatggaggctggcaggacgcaacaactccatcttctgtgacttctcctacggaaggcccgggcagcgtgcactcggatacctctaactaatcctggcctctcccagctgtcatgccttgacaagcgcattcggagcaataggaggaggagggaagcgttttgtaacccaccacctacagctttactgtaaaccctgtcttcttagagaactcgggaaacctgttttttaaggaatcataaccatttgtatttaaacttaagacacacgtttaaaggaaagcactttatccgattaggccgagacgtaacattgttgacagttcttaactgtctcatcctaatttattattacattttacagtaatggttccacagttgccagttccttggccttaagggtaagaagtaccatctatgctagaccccaattatagagcaggcaaggttcaccctgcctacgctgagccctggcggatttccatgcaggctctcatcgttctcacgtcacggatgggcttggagggaaggcgatgtctgcctgtcttcttaaggaaggcatttcagaacttccctcgccatgtttgtgttgccatctcttatgttgtaattaggtcaaagactggtggcctcctttctccctctgaagtaccagagcccggagtctgcgctaatgagaccatggatccagattgccctgagatgaagatcttgctgctacagaggtgaaaacaagacctgtctggggtttgaccgtgtgcgctgggtgctgcacagacttgtcaaggtgtgctcttcctctgggcagcctggaaaggccctgctctctggagtgctgtatatagtgtagcaaaagagtatttatacatcccaccaatcaaaacacagctttattacctcatgcgaactcatacaaaccaatagaatcccaacatgttctgtagcttagagcgctcacttactacctctgaacaatactcacgctgtagttcgtctctttcttatctttttgcatcttgtaattaactctttgtttcccttcacaaaatgtaatgtacatt
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]