GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2026-06-12 02:19:33, GGRNA.v2 : RefSeq release 233 (Jan, 2026)

LOCUS       NM_001107094            1848 bp    mRNA    linear   ROD 20-MAR-2023
DEFINITION  Rattus norvegicus homeo box D10 (Hoxd10), mRNA.
ACCESSION   NM_001107094 XM_001063804 XM_221510
VERSION     NM_001107094.1
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 1848)
  AUTHORS   Ruan Z, Li Y, He R and Li X.
  TITLE     Inhibition of microRNA-10b-5p up-regulates HOXD10 to attenuate
            Alzheimer's disease in rats via the Rho/ROCK signalling pathway
  JOURNAL   J Drug Target 29 (5), 531-540 (2021)
   PUBMED   33307856
  REMARK    GeneRIF: Inhibition of microRNA-10b-5p up-regulates HOXD10 to
            attenuate Alzheimer's disease in rats via the Rho/ROCK signalling
            pathway.
REFERENCE   2  (bases 1 to 1848)
  AUTHORS   Wang R, Huang Q, Zhou R, Dong Z, Qi Y, Li H, Wei X, Wu H, Wang H,
            Wilcox CS, Hultstrom M, Zhou X and Lai EY.
  TITLE     Sympathoexcitation in Rats With Chronic Heart Failure Depends on
            Homeobox D10 and MicroRNA-7b Inhibiting GABBR1 Translation in
            Paraventricular Nucleus
  JOURNAL   Circ Heart Fail 9 (1), e002261 (2016)
   PUBMED   26699387
  REMARK    GeneRIF: ANG II/AT1R/HoxD10/miR-7b/GABBR1 pathway in the PVN
            contributes to sympathoexcitation and deterioration of cardiac
            function in heart failure.
REFERENCE   3  (bases 1 to 1848)
  AUTHORS   Raines AM, Adam M, Magella B, Meyer SE, Grimes HL, Dey SK and
            Potter SS.
  TITLE     Recombineering-based dissection of flanking and paralogous Hox gene
            functions in mouse reproductive tracts
  JOURNAL   Development 140 (14), 2942-2952 (2013)
   PUBMED   23760953
REFERENCE   4  (bases 1 to 1848)
  AUTHORS   Seki T, Shimokawa N, Iizuka H, Takagishi K and Koibuchi N.
  TITLE     Abnormalities of vertebral formation and Hox expression in
            congenital kyphoscoliotic rats
  JOURNAL   Mol Cell Biochem 312 (1-2), 193-199 (2008)
   PUBMED   18327665
REFERENCE   5  (bases 1 to 1848)
  AUTHORS   Wu Y, Wang G, Scott SA and Capecchi MR.
  TITLE     Hoxc10 and Hoxd10 regulate mouse columnar, divisional and motor
            pool identity of lumbar motoneurons
  JOURNAL   Development 135 (1), 171-182 (2008)
   PUBMED   18065432
REFERENCE   6  (bases 1 to 1848)
  AUTHORS   Wellik DM and Capecchi MR.
  TITLE     Hox10 and Hox11 genes are required to globally pattern the
            mammalian skeleton
  JOURNAL   Science 301 (5631), 363-367 (2003)
   PUBMED   12869760
REFERENCE   7  (bases 1 to 1848)
  AUTHORS   Pan L, Xie Y, Black TA, Jones CA, Pruitt SC and Gross KW.
  TITLE     An Abd-B class HOX.PBX recognition sequence is required for
            expression from the mouse Ren-1c gene
  JOURNAL   J Biol Chem 276 (35), 32489-32494 (2001)
   PUBMED   11432851
REFERENCE   8  (bases 1 to 1848)
  AUTHORS   de la Cruz CC, Der-Avakian A, Spyropoulos DD, Tieu DD and Carpenter
            EM.
  TITLE     Targeted disruption of Hoxd9 and Hoxd10 alters locomotor behavior,
            vertebral identity, and peripheral nervous system development
  JOURNAL   Dev Biol 216 (2), 595-610 (1999)
   PUBMED   10642795
REFERENCE   9  (bases 1 to 1848)
  AUTHORS   Carpenter EM, Goddard JM, Davis AP, Nguyen TP and Capecchi MR.
  TITLE     Targeted disruption of Hoxd-10 affects mouse hindlimb development
  JOURNAL   Development 124 (22), 4505-4514 (1997)
   PUBMED   9409668
REFERENCE   10 (bases 1 to 1848)
  AUTHORS   Zappavigna V, Renucci A, Izpisua-Belmonte JC, Urier G, Peschle C
            and Duboule D.
  TITLE     HOX4 genes encode transcription factors with potential auto- and
            cross-regulatory capacities
  JOURNAL   EMBO J 10 (13), 4177-4187 (1991)
   PUBMED   1756725
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from CH473949.1.
            
            On or before Oct 4, 2007 this sequence version replaced
            XM_221510.4, XM_001063804.1.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            RNAseq introns :: single sample supports all introns SAMEA5760384,
                              SAMEA5760475 [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..1848
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /db_xref="taxon:10116"
                     /chromosome="3"
                     /map="3q23"
     gene            1..1848
                     /gene="Hoxd10"
                     /note="homeo box D10"
                     /db_xref="GeneID:303991"
                     /db_xref="RGD:1306511"
     exon            1..845
                     /gene="Hoxd10"
                     /inference="alignment:Splign:2.1.0"
     CDS             101..1123
                     /gene="Hoxd10"
                     /codon_start=1
                     /product="homeobox protein Hox-D10"
                     /protein_id="NP_001100564.1"
                     /db_xref="GeneID:303991"
                     /db_xref="RGD:1306511"
                     /translation="
MSFPNSSPAANTFLVDSLISACRSDSFYSSSASMYMPPPSADMGTYGMQTCGLLPSLAKREVNHQNMGMNVHPYIPQVDSWTDPNRSCRIEQPVTQQVPTCSFTANIKEESNCCMYSDKRNKLISAEVPSYQRLVPESCPVENPEVPVPGYFRLSQTYATGKTQEYNNNPEGSSTVMLQLNPRGAAKPQLSAAQLQMEKKMNETASGQEPTKVSQVESPEAKGGLPEERSCLAEVSVSSPEVQEKESKEEIKSDTPTSNWLTAKSGRKKRCPYTKHQTLELEKEFLFNMYLTRERRLEISKSVNLTDRQVKIWFQNRRMKLKKMSRENRIRELTANLTFS"
     misc_feature    899..1069
                     /gene="Hoxd10"
                     /note="Region: Homeodomain; pfam00046"
                     /db_xref="CDD:459649"
     exon            846..1848
                     /gene="Hoxd10"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
atgtggtcggcagaggcatccacaattacaccgggaatgttttcctagcgatgtcagcctacaaaggacacaatctctcttcttcaaattcctccccaaaatgtcctttcccaacagctctcctgctgctaatacttttttagtagattccttgatcagtgcctgcaggagtgacagtttttattcgagcagcgccagcatgtacatgccaccacctagcgcagacatggggacctatggaatgcaaacctgtggactgctcccgtctctggccaaaagagaagtgaaccaccaaaatatgggtatgaatgtacatccttatatacctcaagtagacagttggacagacccgaacagatcttgtcgaatagagcaacctgttacacagcaagtccccacttgctcattcaccgccaacattaaagaagaatccaattgctgcatgtattctgataagcgcaacaaactcatttctgccgaggtcccttcgtaccagaggctggtccccgagtcttgtcctgttgagaaccccgaggttcctgtccctggatattttagactgagtcagacctacgccaccgggaaaacccaagagtacaataacaaccccgaaggcagctccactgtcatgctccagctcaaccctcgtggcgcggccaagccgcagctctcggctgcccagctgcagatggaaaagaagatgaacgaaaccgcgagcggccaggagcccactaaagtctcccaagtggagagccccgaggccaaaggcggccttccagaagagaggagctgcctggctgaggtctccgtgtccagccccgaagtgcaggagaaggaaagcaaagaggaaatcaagtctgatactccaaccagcaattggctcactgcaaagagtggcagaaagaagaggtgcccttacactaaacaccaaacgctggaattagaaaaagagttcttgttcaatatgtacctcacccgcgagcgccgcctagagatcagtaagagcgttaacctcaccgacaggcaggtcaagatttggtttcaaaaccgccgaatgaaactcaagaagatgagccgagagaatcgaatccgagaactgaccgccaacctcaccttttcttaggtctgaggcccatgtgaggccaggatccgagagggggcaccgagttccaggcccgagtactgaaggactagggaggcggaaacaaaaccttcattgctctttggttgttttgttttgttttgttttgttctgttctgttttcctgctagaatgtgactttggggtcattctgttcgtgctgcaagtgatctgtaatccctacgagtatacatatatatatattaaaaaaacttagcacgtgtaatttattttttcatcgtaatgcagggtaactattactgcgcattttcatttgggtcttaacttattggaactgtagagcatccatctaaccttatccacccagccagccagccagcaatgtgacttttccatgtttttcctaacataaaagttctctctgtgtgtggttagcccatgaactcatgacattttgaaaacatccagtacttaaaaaaaacaacaaaaaaatcctatatctatatatatttcaaaagattaagaaaacccacaagctttgggggggagggggactttaaaagcacattacaatgtatcttttcacaaacgaacttagcaattgtccttggtgaaatggattattgacttatgccttgtagcctttccttgtggtgcatctgtggtttggtagaaatacaagagcaacctgtgcttttttgtgcatgttctggtcgcatgtgtaatgcaataaactctggaaatga
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]