2024-04-28 15:48:31, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_001100907 920 bp mRNA linear ROD 20-MAR-2023 DEFINITION Rattus norvegicus homeobox C9 (Hoxc9), mRNA. ACCESSION NM_001100907 XM_347335 VERSION NM_001100907.1 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 920) AUTHORS McIntyre DC, Rakshit S, Yallowitz AR, Loken L, Jeannotte L, Capecchi MR and Wellik DM. TITLE Hox patterning of the vertebrate rib cage JOURNAL Development 134 (16), 2981-2989 (2007) PUBMED 17626057 REFERENCE 2 (bases 1 to 920) AUTHORS Nauta AJ, Daha MR, Tijsma O, van de Water B, Tedesco F and Roos A. TITLE The membrane attack complex of complement induces caspase activation and apoptosis JOURNAL Eur J Immunol 32 (3), 783-792 (2002) PUBMED 11870622 REMARK GeneRIF: The membrane attack complex of complement induces caspase activation and apoptosis. REFERENCE 3 (bases 1 to 920) AUTHORS Suemori H, Takahashi N and Noguchi S. TITLE Hoxc-9 mutant mice show anterior transformation of the vertebrae and malformation of the sternum and ribs JOURNAL Mech Dev 51 (2-3), 265-273 (1995) PUBMED 7547473 REFERENCE 4 (bases 1 to 920) AUTHORS Sakoyama Y, Mizuta I, Ogasawara N and Yoshikawa H. TITLE Cloning of rat homeobox genes JOURNAL Biochem Genet 32 (9-10), 351-360 (1994) PUBMED 7702549 REFERENCE 5 (bases 1 to 920) AUTHORS Chung SY, Dai PH, Lei J, Riviere M, Levan G, Szpirer J and Szpirer C. TITLE Chromosomal assignment of seven rat homeobox genes to rat chromosomes 3, 4, 7, and 10 JOURNAL Mamm Genome 4 (9), 537-540 (1993) PUBMED 7906969 REFERENCE 6 (bases 1 to 920) AUTHORS Falzon M and Chung SY. TITLE The expression of rat homeobox-containing genes is developmentally regulated and tissue specific JOURNAL Development 103 (3), 601-610 (1988) PUBMED 2907739 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from JACYVU010000187.1. On Oct 21, 2010 this sequence version replaced XM_347335.4. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. ##Evidence-Data-START## Transcript exon combination :: BQ208027.1, BQ205031.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMD00132263, SAMD00132264 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on single protein-coding transcript ##RefSeq-Attributes-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-538 JACYVU010000187.1 20853316-20853853 539-920 JACYVU010000187.1 20855615-20855996 FEATURES Location/Qualifiers source 1..920 /organism="Rattus norvegicus" /mol_type="mRNA" /strain="BN" /db_xref="taxon:10116" /chromosome="7" /map="7q36" gene 1..920 /gene="Hoxc9" /gene_synonym="Hoxc8" /note="homeobox C9" /db_xref="GeneID:368178" /db_xref="RGD:1595784" CDS 1..783 /gene="Hoxc9" /gene_synonym="Hoxc8" /note="homeo box C9" /codon_start=1 /product="homeobox protein Hox-C9" /protein_id="NP_001094377.1" /db_xref="GeneID:368178" /db_xref="RGD:1595784" /translation="
MSATGPISNYYVDSLISHDNEDLLASRFPATGAHPAAARPSGLVPDCSDFPSCSFAPKPAVFSTSWAPVPSQSSVVYHPYGPQPHLGADTRYMRTWLEPLSGAVSFPSFPAGGRHYALKPDAYPGRRADCGPGDGRSYPDYMYGSPGELRDRAPQTLPSPEADALAGSKHKEEKADLDPSNPVANWIHARSTRKKRCPYTKYQTLELEKEFLFNMYLTRDRRYEVARVLNLTERQVKIWFQNRRMKMKKMNKEKTDKEQS"
misc_feature 1..537 /gene="Hoxc9" /gene_synonym="Hoxc8" /note="Hox9 activation region; Region: Hox9_act; pfam04617" /db_xref="CDD:428038" misc_feature 574..723 /gene="Hoxc9" /gene_synonym="Hoxc8" /note="Homeodomain; Region: HOX; smart00389" /db_xref="CDD:197696" exon 1..538 /gene="Hoxc9" /gene_synonym="Hoxc8" /inference="alignment:Splign:2.1.0" exon 539..920 /gene="Hoxc9" /gene_synonym="Hoxc8" /inference="alignment:Splign:2.1.0" ORIGIN
atgtcggcgacggggcccatcagtaactattacgtggactcgctcatctctcacgacaatgaagacctcctagcgtccaggtttccggccaccggggctcaccctgccgccgccagacccagcggcttggtgccggactgtagcgattttccgtcctgtagcttcgcgcccaagccggctgtattcagcacgtcgtgggcgcccgtgccctcgcagtcgtccgtggtctatcacccttacggcccccagccccacctcggcgccgacacgcgctacatgcggacttggctcgagccgctgtccggcgccgtctccttccccagcttcccagccgggggccgtcactacgccctcaagcccgacgcctaccccgggcgccgcgccgactgcggcccgggcgacggccgcagctacccggactacatgtacggctctcccggggaactgcgcgaccgcgccccgcagacgctgccctcgcccgaggcggacgcgctggccggcagcaagcacaaagaggagaaggccgacctggaccctagcaaccccgtggccaactggatccatgcccgttccacaaggaagaagcgctgcccctacaccaagtaccagacgctggaactggagaaggagtttctcttcaatatgtatttaactagggaccgtcggtacgaggtggcccgtgttctcaatctcactgagcggcaggtcaaaatctggtttcagaaccggaggatgaaaatgaaaaagatgaataaagaaaaaaccgacaaagaacaatcctaaaccctgccccagcctgctgcctcggcacagccaagggaaacacaaaaaccccaccaaaaaatgccccaactcaggcgggagaaagcacgaaaagaaaaggaaagaacaagatagagaaaagcccaacgtcttaaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]