2025-04-20 02:26:17, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS NM_001082540 1571 bp mRNA linear ROD 03-APR-2024 DEFINITION Rattus norvegicus heterogeneous nuclear ribonucleoprotein D (Hnrnpd), transcript variant 3, mRNA. ACCESSION NM_001082540 VERSION NM_001082540.1 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 1571) AUTHORS Yan,J., Du,F., Li,S.D., Yuan,Y., Jiang,J.Y., Li,S., Li,X.Y. and Du,Z.X. TITLE AUF1 modulates TGF-beta signal in renal tubular epithelial cells via post-transcriptional regulation of Nedd4L expression JOURNAL Biochim Biophys Acta Mol Cell Res 1865 (1), 48-56 (2018) PUBMED 28986222 REMARK GeneRIF: AUF1 might be a potential player in renal tubulointerstitial fibrosis through modulation of TGF-beta signal transduction via posttranscriptional regulation of Nedd4L. REFERENCE 2 (bases 1 to 1571) AUTHORS Castellanos-Rubio,A., Fernandez-Jimenez,N., Kratchmarov,R., Luo,X., Bhagat,G., Green,P.H., Schneider,R., Kiledjian,M., Bilbao,J.R. and Ghosh,S. TITLE A long noncoding RNA associated with susceptibility to celiac disease JOURNAL Science 352 (6281), 91-95 (2016) PUBMED 27034373 REFERENCE 3 (bases 1 to 1571) AUTHORS Lee,K.H., Kim,S.H., Kim,H.J., Kim,W., Lee,H.R., Jung,Y., Choi,J.H., Hong,K.Y., Jang,S.K. and Kim,K.T. TITLE AUF1 contributes to Cryptochrome1 mRNA degradation and rhythmic translation JOURNAL Nucleic Acids Res 42 (6), 3590-3606 (2014) PUBMED 24423872 REFERENCE 4 (bases 1 to 1571) AUTHORS Baltz,A.G., Munschauer,M., Schwanhausser,B., Vasile,A., Murakawa,Y., Schueler,M., Youngs,N., Penfold-Brown,D., Drew,K., Milek,M., Wyler,E., Bonneau,R., Selbach,M., Dieterich,C. and Landthaler,M. TITLE The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts JOURNAL Mol Cell 46 (5), 674-690 (2012) PUBMED 22681889 REFERENCE 5 (bases 1 to 1571) AUTHORS Castello,A., Fischer,B., Eichelbaum,K., Horos,R., Beckmann,B.M., Strein,C., Davey,N.E., Humphreys,D.T., Preiss,T., Steinmetz,L.M., Krijgsveld,J. and Hentze,M.W. TITLE Insights into RNA biology from an atlas of mammalian mRNA-binding proteins JOURNAL Cell 149 (6), 1393-1406 (2012) PUBMED 22658674 REFERENCE 6 (bases 1 to 1571) AUTHORS Raineri,I., Wegmueller,D., Gross,B., Certa,U. and Moroni,C. TITLE Roles of AUF1 isoforms, HuR and BRF1 in ARE-dependent mRNA turnover studied by RNA interference JOURNAL Nucleic Acids Res 32 (4), 1279-1288 (2004) PUBMED 14976220 REMARK Publication Status: Online-Only REFERENCE 7 (bases 1 to 1571) AUTHORS Arao,Y., Kikuchi,A., Ikeda,K., Nomoto,S., Horiguchi,H. and Kayama,F. TITLE A+U-rich-element RNA-binding factor 1/heterogeneous nuclear ribonucleoprotein D gene expression is regulated by oestrogen in the rat uterus JOURNAL Biochem J 361 (Pt 1), 125-132 (2002) PUBMED 11742537 REFERENCE 8 (bases 1 to 1571) AUTHORS Faura,M., Renau-Piqueras,J., Bachs,O. and Bosser,R. TITLE Differential distribution of heterogeneous nuclear ribonucleoproteins in rat tissues JOURNAL Biochem Biophys Res Commun 217 (2), 554-560 (1995) PUBMED 7503735 REFERENCE 9 (bases 1 to 1571) AUTHORS Ehrenman,K., Long,L., Wagner,B.J. and Brewer,G. TITLE Characterization of cDNAs encoding the murine A+U-rich RNA-binding protein AUF1 JOURNAL Gene 149 (2), 315-319 (1994) PUBMED 7959009 REFERENCE 10 (bases 1 to 1571) AUTHORS Ishikawa,F., Matunis,M.J., Dreyfuss,G. and Cech,T.R. TITLE Nuclear proteins that bind the pre-mRNA 3' splice site sequence r(UUAG/G) and the human telomeric DNA sequence d(TTAGGG)n JOURNAL Mol Cell Biol 13 (7), 4301-4310 (1993) PUBMED 8321232 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from CO567918.1, AB046617.1 and CB798484.1. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## CDS exon combination :: AB046617.1 [ECO:0000331] RNAseq introns :: single sample supports all introns SAMD00132261, SAMD00132262 [ECO:0000348] ##Evidence-Data-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-436 CO567918.1 1-436 437-1200 AB046617.1 152-915 1201-1571 CB798484.1 23-393 FEATURES Location/Qualifiers source 1..1571 /organism="Rattus norvegicus" /mol_type="mRNA" /db_xref="taxon:10116" /chromosome="14" /map="14p22" gene 1..1571 /gene="Hnrnpd" /gene_synonym="Auf1; Hnrpd" /note="heterogeneous nuclear ribonucleoprotein D" /db_xref="GeneID:79256" /db_xref="RGD:620365" exon 1..512 /gene="Hnrnpd" /gene_synonym="Auf1; Hnrpd" /inference="alignment:Splign:2.1.0" misc_feature 187..189 /gene="Hnrnpd" /gene_synonym="Auf1; Hnrpd" /note="upstream in-frame stop codon" CDS 286..1200 /gene="Hnrnpd" /gene_synonym="Auf1; Hnrpd" /note="isoform c is encoded by transcript variant 3; heterogeneous nuclear ribonucleoprotein D0; hnRNP D0; AU-rich element RNA-binding protein 1; AU-rich element RNA-binding factor 1; RNA binding protein p45AUF1" /codon_start=1 /product="heterogeneous nuclear ribonucleoprotein D0 isoform c" /protein_id="NP_001076009.1" /db_xref="GeneID:79256" /db_xref="RGD:620365" /translation="
MSEEQFGGDGAAAAATAAVGGSAGEQEGAMVAAAQGAAAAAGSGSGGGSAPGGTEGGSTEAEGAKIDASKNEEDEGHSNSSPRHTEAATAQREEWKMFIGGLSWDTTKKDLKDYFSKFGDVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRAKAMKTKEPVKKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVAMSKEQYQQQQQWGSRGGFAGRARGRGGDQQSGYGKVSRRGGHQNSYKPY"
misc_feature <448..513 /gene="Hnrnpd" /gene_synonym="Auf1; Hnrpd" /note="CBFNT (NUC161) domain; Region: CBFNT; pfam08143" /db_xref="CDD:311868" misc_feature 574..795 /gene="Hnrnpd" /gene_synonym="Auf1; Hnrpd" /note="RNA recognition motif 1 (RRM1) found in heterogeneous nuclear ribonucleoprotein D0 (hnRNP D0) and similar proteins; Region: RRM1_hnRNPD; cd12756" /db_xref="CDD:410150" misc_feature 826..1050 /gene="Hnrnpd" /gene_synonym="Auf1; Hnrpd" /note="RNA recognition motif 2 (RRM2) found in heterogeneous nuclear ribonucleoprotein D0 (hnRNP D0) and similar proteins; Region: RRM2_hnRNPD; cd12583" /db_xref="CDD:241027" misc_feature order(826..828,832..834,838..843,913..924,928..933, 940..948,952..954,958..960,1009..1011,1030..1038, 1042..1050) /gene="Hnrnpd" /gene_synonym="Auf1; Hnrpd" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:241027" exon 513..569 /gene="Hnrnpd" /gene_synonym="Auf1; Hnrpd" /inference="alignment:Splign:2.1.0" exon 570..738 /gene="Hnrnpd" /gene_synonym="Auf1; Hnrpd" /inference="alignment:Splign:2.1.0" exon 739..900 /gene="Hnrnpd" /gene_synonym="Auf1; Hnrpd" /inference="alignment:Splign:2.1.0" exon 901..1032 /gene="Hnrnpd" /gene_synonym="Auf1; Hnrpd" /inference="alignment:Splign:2.1.0" exon 1033..1132 /gene="Hnrnpd" /gene_synonym="Auf1; Hnrpd" /inference="alignment:Splign:2.1.0" exon 1133..1230 /gene="Hnrnpd" /gene_synonym="Auf1; Hnrpd" /inference="alignment:Splign:2.1.0" exon 1231..1558 /gene="Hnrnpd" /gene_synonym="Auf1; Hnrpd" /inference="alignment:Splign:2.1.0" ORIGIN
gcggcggcgccattaaagcgaggaggaggcgagagtggccgccgctgctacttattcttttttagtgcagccggggagagtgagagtgcgcgctgcgcgagagtgggaggcgaggggggcaggccggggagaggcgcaggagcctttgcagccacgcgcgcgccttgtcttgtgtgcctcgcgaggtagagcgggcgcgcggcggcggcggggattactttgctgctagtttcggttcgcggcggcggcgggtgtcgtctcggcggcggcggaggcagtagcactatgtcggaggagcagttcggaggggacggggcggcggcggcggcaacggcggcggtaggcggctcggcgggcgagcaggagggagccatggtggcggcggcgcagggggcagcggcggcggcgggaagcgggagcggcggcggctctgcgcccggaggcaccgaaggaggcagcaccgaggcagagggagcgaagatcgacgccagtaagaatgaggaggatgaaggccattcaaactcctccccacgacacactgaagcagcgacggcacagcgggaagaatggaaaatgtttataggaggccttagctgggacaccacaaagaaagacctgaaggactacttttccaaatttggggacgttgtagactgcactctgaagttagatcctatcacagggcgatcaaggggttttggctttgtgctatttaaagagtcggagagtgtagataaggtcatggatcagaaagaacataaattgaatgggaaagtcattgatcctaaaagggccaaagccatgaaaacaaaagagcccgtcaaaaaaatttttgttggtggcctttctccagacacacctgaagaaaaaataagagagtactttggtggttttggtgaggttgaatccatagagctgcctatggacaacaagaccaataagaggcgtgggttctgtttcattacctttaaggaagaggaaccagtgaagaagataatggagaagaaataccacaatgttggtcttagtaaatgtgaaataaaagtagccatgtcgaaggagcagtatcagcagcagcagcagtggggatctagaggagggtttgcaggaagagctcgcggaagaggcggtgatcagcagagtggttatgggaaagtatccagacgaggtggtcatcaaaatagctacaaaccatactaaattattccatttgcaacttatccccaacaggtggtgaagcagtattttccaatttgaagattcatttgaaggtggctcctgccacctgctaatagcagttcaaactaaattttttctatcaagttcccgaatggaagtatgacgttgggtccctctgaagtttaattctgagttctcattaaaagaatttgctttcattgttttatttcttaattgctatgcttcagtatcaatttgtgttttatgcccccctcccccccagtattgtagagcaagtcttgtgttacaagcccagtgtgacagtgtcatgatgtagtagtgtcttactggttttttaataaatccttttgtataaaaaaaaaaaaaaaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]