2024-04-28 08:26:00, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_001037581 714 bp mRNA linear ROD 21-MAR-2023 DEFINITION Rattus norvegicus reproductive homeobox 10 (Rhox10), mRNA. ACCESSION NM_001037581 VERSION NM_001037581.2 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 714) AUTHORS Borgmann J, Tuttelmann F, Dworniczak B, Ropke A, Song HW, Kliesch S, Wilkinson MF, Laurentino S and Gromoll J. TITLE The human RHOX gene cluster: target genes and functional analysis of gene variants in infertile men JOURNAL Hum Mol Genet 25 (22), 4898-4910 (2016) PUBMED 28171660 REFERENCE 2 (bases 1 to 714) AUTHORS Geserick C, Weiss B, Schleuning WD and Haendler B. TITLE OTEX, an androgen-regulated human member of the paired-like class of homeobox genes JOURNAL Biochem J 366 (Pt 1), 367-375 (2002) PUBMED 11980563 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from JACYVU010000455.1. On Aug 30, 2022 this sequence version replaced NM_001037581.1. ##Evidence-Data-START## Transcript exon combination :: DQ058657.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMN13663609 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on single protein-coding transcript ##RefSeq-Attributes-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-418 JACYVU010000455.1 1807381-1807798 419-464 JACYVU010000455.1 1809799-1809844 465-714 JACYVU010000455.1 1811678-1811927 FEATURES Location/Qualifiers source 1..714 /organism="Rattus norvegicus" /mol_type="mRNA" /strain="BN" /db_xref="taxon:10116" /chromosome="X" /map="Xq35" gene 1..714 /gene="Rhox10" /gene_synonym="Rhoxf10" /note="reproductive homeobox 10" /db_xref="GeneID:652926" /db_xref="RGD:1563291" exon 1..418 /gene="Rhox10" /gene_synonym="Rhoxf10" /inference="alignment:Splign:2.1.0" misc_feature 6..8 /gene="Rhox10" /gene_synonym="Rhoxf10" /note="upstream in-frame stop codon" CDS 54..659 /gene="Rhox10" /gene_synonym="Rhoxf10" /note="reproductive homeobox on X chromosome 10; Rhox homeobox family member 10" /codon_start=1 /product="reproductive homeobox 10" /protein_id="NP_001032670.1" /db_xref="GeneID:652926" /db_xref="RGD:1563291" /translation="
MESKYFYFDLDYYGVSFYEEEIMTDSQQRVAAAAVRCRFGRGVRVLHELGQDEHLSFKYKQNYSYETRKETQARPSEPEKAAGTAACRSNNRQIKHHKFTYAQLCELEKAFQETQYPDAHRRKALAALIHVDECKVKAWFKNKRAKYRKKHKELLLSSATSGTLNNFSAQMNEDPKSSTSVPEEPIGFIVCQQHLGKSCWS"
misc_feature order(336..344,348..350,399..401,417..419,456..458, 462..467,474..479,483..491,495..500) /gene="Rhox10" /gene_synonym="Rhoxf10" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature order(336..338,345..347,465..467,474..479,486..488) /gene="Rhox10" /gene_synonym="Rhoxf10" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 348..497 /gene="Rhox10" /gene_synonym="Rhoxf10" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:425441" exon 419..464 /gene="Rhox10" /gene_synonym="Rhoxf10" /inference="alignment:Splign:2.1.0" exon 465..714 /gene="Rhox10" /gene_synonym="Rhoxf10" /inference="alignment:Splign:2.1.0" ORIGIN
gcccgtgaactgggaggtgctccagagtaggctccatctgcaaagctctagcaatggaaagcaagtacttctacttcgacctcgactattatggggtgagcttctatgaggaagaaataatgactgactctcagcagagggttgccgcggcagcagtccgttgtcgctttggaagaggtgtaagagtcctgcatgagctaggccaggacgagcacctgagctttaaatacaagcaaaactacagctatgaaacaaggaaggaaacgcaagcccgtcccagtgagcctgagaaagcagctggaacagctgcttgtcgctccaacaacaggcaaataaaacaccacaagttcacctatgcccaactgtgtgaactggagaaggctttccaagagacccagtatcctgatgcacaccgaagaaaagcacttgcagccctcattcatgtggacgaatgcaaggtgaaggcttggtttaaaaataagagagctaaatacaggaaaaaacataaggaattactactcagcagtgctacatctggtaccttgaacaacttttctgctcagatgaatgaagaccccaagagtagtacctctgttccggaggagccaatagggttcatcgtgtgccagcaacatcttggcaaatcctgctggtcataaaaatattgttttgtcacatataatagcaataaagaaaggaagatgtttctcaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]