2024-04-27 22:30:32, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_001025776 738 bp mRNA linear ROD 21-MAR-2023 DEFINITION Rattus norvegicus reproductive homeobox 8 (Rhox8), mRNA. ACCESSION NM_001025776 XM_578961 VERSION NM_001025776.1 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from DQ058655.1. On Jul 22, 2005 this sequence version replaced XM_578961.1. ##Evidence-Data-START## Transcript exon combination :: DQ058655.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA5760383, SAMEA5760389 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on single protein-coding transcript ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..738 /organism="Rattus norvegicus" /mol_type="mRNA" /strain="Sprague-Dawley" /db_xref="taxon:10116" /chromosome="X" /map="Xq35" gene 1..738 /gene="Rhox8" /note="reproductive homeobox 8" /db_xref="GeneID:503423" /db_xref="RGD:1561047" CDS 1..537 /gene="Rhox8" /note="reproductive homeobox on X chromosome 8; Rhox homeobox family member 8" /codon_start=1 /product="reproductive homeobox 8" /protein_id="NP_001020947.1" /db_xref="GeneID:503423" /db_xref="RGD:1561047" /translation="
MEPQEVTQYSHLRDDQIKESNEAAAWIVLQDIKEREEKEVVQGYPMLDTTATEGEGANEEESRDEITPAGSSASASVDDRSQDGGTSSNDQDKGQQKEPIPGSTKGHQASPRLPGQLSRNRHRFTEFQLQELERIFERNHYPSAAARRELARWIGVTESRVENWFKSRRAKYRKCLRM"
misc_feature order(355..366,370..372,421..423,439..441,478..480, 484..489,496..501,505..513,517..522) /gene="Rhox8" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature order(358..360,367..369,487..489,496..501,508..510) /gene="Rhox8" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 361..519 /gene="Rhox8" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:425441" exon 1..64 /gene="Rhox8" /inference="alignment:Splign:2.1.0" exon 65..440 /gene="Rhox8" /inference="alignment:Splign:2.1.0" exon 441..486 /gene="Rhox8" /inference="alignment:Splign:2.1.0" exon 487..738 /gene="Rhox8" /inference="alignment:Splign:2.1.0" ORIGIN
atggaacctcaagaagtcacccagtattctcatctgagagatgatcaaattaaagaaagcaatgaagcagctgcgtggatagttttacaggatataaaggagagagaggagaaagaagttgtacagggctaccctatgttggacaccacagctacagaaggagaaggtgcaaatgaagaagaatccagagatgaaataactcctgctggcagttcagcctcagcctctgtagatgacagaagccaggatggcgggaccagcagcaatgaccaggataaaggccaacaaaaggagccaatccctgggagcacaaaaggccatcaggcttccccacgtctaccaggccagctgtcccgcaaccgccacaggttcaccgagttccagctccaggagctggagcgcattttcgaacgtaatcactatcctagtgctgcagcccgaagggagctcgcaagatggataggtgtgacagaatccagagtggagaattggtttaagagtaggagagccaagtacaggaaatgcctgaggatgtaagtgctctgaagtgctcctcatggtgctcactgtagctgcacctttccctaaagattgcggaggagaactagagaaccacctttgcccagaagcggatgagattttgctgccaccaacccattgttctaaccactcccccctcctatcttactcttatctcctcagctcttttaattgcaataaagtggtgaaatctcaata
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]