GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-04-28 05:26:12, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_001024873             864 bp    mRNA    linear   ROD 21-MAR-2023
DEFINITION  Rattus norvegicus Rhox homeobox family member 11 (Rhox11), mRNA.
ACCESSION   NM_001024873 XM_233320
VERSION     NM_001024873.2
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 864)
  AUTHORS   Gaudet P, Livstone MS, Lewis SE and Thomas PD.
  TITLE     Phylogenetic-based propagation of functional annotations within the
            Gene Ontology consortium
  JOURNAL   Brief Bioinform 12 (5), 449-462 (2011)
   PUBMED   21873635
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            JACYVU010000455.1.
            
            On Sep 1, 2022 this sequence version replaced NM_001024873.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: DQ058658.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA5760389 [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-568               JACYVU010000455.1  1828630-1829197
            569-614             JACYVU010000455.1  1833427-1833472
            615-864             JACYVU010000455.1  1836848-1837097
FEATURES             Location/Qualifiers
     source          1..864
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /strain="BN"
                     /db_xref="taxon:10116"
                     /chromosome="X"
                     /map="Xq35"
     gene            1..864
                     /gene="Rhox11"
                     /note="Rhox homeobox family member 11"
                     /db_xref="GeneID:298346"
                     /db_xref="RGD:1564332"
     exon            1..568
                     /gene="Rhox11"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    177..179
                     /gene="Rhox11"
                     /note="upstream in-frame stop codon"
     CDS             192..839
                     /gene="Rhox11"
                     /note="reproductive homeobox on X chromosome 11;
                     reproductive homeobox 11"
                     /codon_start=1
                     /product="Rhox homeobox family member 11"
                     /protein_id="NP_001020044.1"
                     /db_xref="GeneID:298346"
                     /db_xref="RGD:1564332"
                     /translation="
MARKYFYFDYDYYGVSFYEEEITTEPQERVAYTANKGGFTDEVTDLLKELLYQGGRSTIVEHSYRGCDMSNIQDTEHEPEETRNADETSEQLLFRIPRKPYKFTPGQLWEMQAVFEETQYPDAFRRKELAELMNVDEQKVKDWFNNKRAKLRKIQREILKGKIITPTQDELRMKTLVESKNVIIFQEQVGDGLFWDHQNFDTRAVQDSPISLLFL"
     misc_feature    480..656
                     /gene="Rhox11"
                     /note="Homeodomain; DNA binding domains involved in the
                     transcriptional regulation of key eukaryotic developmental
                     processes; may bind to DNA as monomers or as homo- and/or
                     heterodimers, in a sequence-specific manner; Region:
                     homeodomain; cd00086"
                     /db_xref="CDD:238039"
     misc_feature    order(480..494,498..500,549..551,567..569,606..608,
                     612..617,624..629,633..641,645..650)
                     /gene="Rhox11"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    order(486..488,495..497,615..617,624..629,636..638)
                     /gene="Rhox11"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     exon            569..614
                     /gene="Rhox11"
                     /inference="alignment:Splign:2.1.0"
     exon            615..864
                     /gene="Rhox11"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
ctcacccaggtttgtaagttgaaaatcaatagcttcggtggagggggacacgtgtccgtgtcagagaggaacgtgtgccgcctagggtcacaattttagtctggagaacccggacagctcctcagagggcttcaaggagcagagcctctctctagaagccacaagggtgcgccttctgaggagcacaggtcatggcccgtaagtacttctacttcgactacgactactatggggtgagcttctatgaggaagaaatcactactgaaccccaggaaagggtggcctacacagcaaacaagggcggctttaccgacgaagtaacagacctcctgaaagagctgttatatcagggcggtcggagcactatagtcgaacatagttaccgaggttgtgacatgagtaacattcaggacactgagcacgaaccagaggagaccaggaacgcggatgagaccagtgagcagttattattcaggattcctcggaaaccatacaaattcacgcctggacagctgtgggaaatgcaggcagtgttcgaagaaactcagtacccagatgccttcagacgaaaagagctggcagagctcatgaatgtggatgaacagaaagtaaaggattggttcaacaataagagagctaaacttaggaagattcagagggaaatactaaagggaaagataatcactcctacccaggacgaacttcgcatgaagactttggtggagtccaagaatgtcatcattttccaggagcaagtgggggatgggctcttctgggatcaccagaactttgacacccgtgctgtccaggacagccctatctcccttctctttctttagcaatagagtacagcattatcccttt
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]