ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2026-08-15 11:20:59, GGRNA.v2 : RefSeq release 233 (Jan, 2026)
LOCUS NM_001015020 1410 bp mRNA linear ROD 20-MAR-2023 DEFINITION Rattus norvegicus TGFB-induced factor homeobox 1 (Tgif1), mRNA. ACCESSION NM_001015020 XM_237524 VERSION NM_001015020.1 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 1410) AUTHORS Li J, Chen L, Sun L, Chen H, Sun Y, Jiang C and Cheng B. TITLE Silencing of TGIF1 in bone mesenchymal stem cells applied to the post-operative rotator cuff improves both functional and histologic outcomes JOURNAL J Mol Histol 46 (3), 241-249 (2015) PUBMED 25782868 REMARK GeneRIF: Silencing TGIF1 in bone mesenchymal stem cells may improve tendon-to-bone insertion site healing. REFERENCE 2 (bases 1 to 1410) AUTHORS Chen,L., Jiang,C., Tiwari,S.R., Shrestha,A., Xu,P., Liang,W., Sun,Y., He,S. and Cheng,B. TITLE TGIF1 Gene Silencing in Tendon-Derived Stem Cells Improves the Tendon-to-Bone Insertion Site Regeneration JOURNAL Cell Physiol Biochem 37 (6), 2101-2114 (2015) PUBMED 26599628 REMARK GeneRIF: study shows that the tendon-derived stem cell modified with TGIF1 gene silencing has promising effects on tendon-to-bone healing which can be further explored as a therapeutic tool in regenerative medicine REFERENCE 3 (bases 1 to 1410) AUTHORS Chio CC, Chang CP, Lin MT, Su FC, Yang CZ, Tseng HY, Liu ZM and Huang HS. TITLE Involvement of TG-interacting factor in microglial activation during experimental traumatic brain injury JOURNAL J Neurochem 131 (6), 816-824 (2014) PUBMED 25319900 REMARK GeneRIF: the increase of transforming growth-interacting factor levels in the activated microglia of the pericontusional cortex of rats with traumatic brain injury REFERENCE 4 (bases 1 to 1410) AUTHORS Davis H, Lewis A, Spencer-Dene B, Tateossian H, Stamp G, Behrens A and Tomlinson I. TITLE FBXW7 mutations typically found in human cancers are distinct from null alleles and disrupt lung development JOURNAL J Pathol 224 (2), 180-189 (2011) PUBMED 21503901 REMARK Erratum:[J Pathol. 2012 Jan;226(1):144] REFERENCE 5 (bases 1 to 1410) AUTHORS Powers SE, Taniguchi K, Yen W, Melhuish TA, Shen J, Walsh CA, Sutherland AE and Wotton D. TITLE Tgif1 and Tgif2 regulate Nodal signaling and are required for gastrulation JOURNAL Development 137 (2), 249-259 (2010) PUBMED 20040491 REFERENCE 6 (bases 1 to 1410) AUTHORS Dai C and Liu Y. TITLE Hepatocyte growth factor antagonizes the profibrotic action of TGF-beta1 in mesangial cells by stabilizing Smad transcriptional corepressor TGIF JOURNAL J Am Soc Nephrol 15 (6), 1402-1412 (2004) PUBMED 15153551 REMARK GeneRIF: Smad transcriptional corepressor TGIF is stabilized by hepatocyte growth factor in mesangial cells, which antagonizes the profibrotic action of TGF-beta1 [TGIF] REFERENCE 7 (bases 1 to 1410) AUTHORS Lecker SH, Jagoe RT, Gilbert A, Gomes M, Baracos V, Bailey J, Price SR, Mitch WE and Goldberg AL. TITLE Multiple types of skeletal muscle atrophy involve a common program of changes in gene expression JOURNAL FASEB J 18 (1), 39-51 (2004) PUBMED 14718385 REFERENCE 8 (bases 1 to 1410) AUTHORS Rombouts K, Niki T, Greenwel P, Vandermonde A, Wielant A, Hellemans K, De Bleser P, Yoshida M, Schuppan D, Rojkind M and Geerts A. TITLE Trichostatin A, a histone deacetylase inhibitor, suppresses collagen synthesis and prevents TGF-beta(1)-induced fibrogenesis in skin fibroblasts JOURNAL Exp Cell Res 278 (2), 184-197 (2002) PUBMED 12169274 REFERENCE 9 (bases 1 to 1410) AUTHORS Yang Y, Hwang CK, D'Souza UM, Lee SH, Junn E and Mouradian MM. TITLE Three-amino acid extension loop homeodomain proteins Meis2 and TGIF differentially regulate transcription JOURNAL J Biol Chem 275 (27), 20734-20741 (2000) PUBMED 10764806 REFERENCE 10 (bases 1 to 1410) AUTHORS Gripp KW, Wotton D, Edwards MC, Roessler E, Ades L, Meinecke P, Richieri-Costa A, Zackai EH, Massague J, Muenke M and Elledge SJ. TITLE Mutations in TGIF cause holoprosencephaly and link NODAL signalling to human neural axis determination JOURNAL Nat Genet 25 (2), 205-208 (2000) PUBMED 10835638 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from BC091264.1. On Apr 20, 2005 this sequence version replaced XM_237524.3. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: BC091264.1, BC127461.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMD00132291, SAMEA5756307 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on single protein-coding transcript ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..1410 /organism="Rattus norvegicus" /mol_type="mRNA" /db_xref="taxon:10116" /chromosome="9" /map="9q38" gene 1..1410 /gene="Tgif1" /gene_synonym="Tfig; Tgif" /note="TGFB-induced factor homeobox 1" /db_xref="GeneID:316742" /db_xref="RGD:1310517" exon 1..106 /gene="Tgif1" /gene_synonym="Tfig; Tgif" /inference="alignment:Splign:2.1.0" misc_feature 1..3 /gene="Tgif1" /gene_synonym="Tfig; Tgif" /note="upstream in-frame stop codon" CDS 49..912 /gene="Tgif1" /gene_synonym="Tfig; Tgif" /note="TG interacting factor 1" /codon_start=1 /product="homeobox protein TGIF1" /protein_id="NP_001015020.1" /db_xref="GeneID:316742" /db_xref="RGD:1310517" /translation="
MIYTSRRCALAGSGWPSRHGVVAAASGSDSEDEDSMDSPLDLSSSAASGKRRRRGNLPKESVQILRDWLYEHRYNAYPSEQEKALLSQQTHLSTLQVCNWFINARRRLLPDMLRKDGKDPNQFTISRRGAKISEASSIEAAMGIKNFMPTLEESPFHSCVVGPNPTLGRPVSPKPPSPGPILARPSVICHTTVTALKDGPFSLCQAVSVGHSTDVQQVAPSNFTDASLRYPEDTCKSGPSPNPQSGLFNTPPPTPPDLNQDFSGFQLLVDVALKQAAEMELQAKLTA"
misc_feature order(199..213,217..219,277..279,295..297,334..336,
340..345,352..357,361..369)
/gene="Tgif1"
/gene_synonym="Tfig; Tgif"
/note="DNA binding site [nucleotide binding]"
/db_xref="CDD:238039"
misc_feature order(205..207,214..216,343..345,352..357,364..366)
/gene="Tgif1"
/gene_synonym="Tfig; Tgif"
/note="specific DNA base contacts [nucleotide binding];
other site"
/db_xref="CDD:238039"
misc_feature 253..369
/gene="Tgif1"
/gene_synonym="Tfig; Tgif"
/note="Homeobox KN domain; Region: Homeobox_KN; pfam05920"
/db_xref="CDD:428673"
exon 107..336
/gene="Tgif1"
/gene_synonym="Tfig; Tgif"
/inference="alignment:Splign:2.1.0"
exon 337..1389
/gene="Tgif1"
/gene_synonym="Tfig; Tgif"
/inference="alignment:Splign:2.1.0"
ORIGIN
tgatctcagaacccggccagcgcgctccggcttcccaactgcctcgaaatgatttacacgagcaggaggtgtgcattggcggggtccggctggccttcgcgtcacggtgttgttgcagcagcatccggcagtgactctgaggatgaagacagtatggacagtcccttggacctttcatcgtcagcggcctctggcaagagaaggaggagaggcaatctgcccaaagagtccgtccagattcttcgagactggctgtatgaacacagatacaacgcatacccctcagagcaagagaaagccctgctgtcgcagcagacacacctgtccacactacaggtctgtaactggttcatcaacgcccgtcgcaggctccttcctgacatgctgagaaaggatggcaaagacccaaatcagttcaccatttcccgccgaggggccaagatctcagaagctagctctattgaagctgcaatgggtatcaaaaacttcatgccaactctagaagagagcccatttcattcctgcgtagttggacccaacccaaccctagggagaccagtgtctcccaaacctccctccccgggacccatcttggctcgcccctcagtgatctgccataccactgtgactgcattgaaggacgggcctttctctctctgccaggcagtcagtgtgggacatagtacagatgtacagcaggtagcacccagcaactttacagacgcctctctcaggtacccagaggacacttgcaaatctggacccagtccaaatcctcagagtggtcttttcaacactcctcccccgactccgccagacctcaaccaggattttagtggatttcagctcctggtggacgttgcgctcaagcaggcagcagagatggagcttcaggccaaactcacagcttaaccgagtgtcaaacaaaacagttctccaaaatacggtcctgaattgccgggggtgatggcaagagatgcattattttatatattttcctattaatatttgcacatgggattgctcaaacgaagcttcctgttactaagatgtcttcaatggaatagtcattccaagaactgcagactaaagctactgtagaaacagagggttttcttttcgaatgtttcttggtagtttctcataatgtgagacgttcccagtatcatgtgatcttctcctcccaactcctttttttttttttcaagactgtgcaatacttagaagcccttgtgcctctctgttcccatgtggaacatgaccccacatacagtctaatgaataaactttcagttttttgtttgtttgtttttttttatagattcaagcaagtatgaatctagttgttggatacctttttcatgatgtaataaagtattttctttaaaaaaaaaaaaaaaaaaaaaaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]