2024-11-23 14:48:59, GGRNA.v2 : RefSeq release 226 (Sep, 2024)
LOCUS XM_066311657 2038 bp mRNA linear PLN 10-JUL-2024 DEFINITION PREDICTED: Oryza sativa Japonica Group uncharacterized protein (LOC9270848), transcript variant X3, mRNA. ACCESSION XM_066311657 VERSION XM_066311657.1 DBLINK BioProject: PRJNA1123306 KEYWORDS RefSeq. SOURCE Oryza sativa Japonica Group (Japanese rice) ORGANISM Oryza sativa Japonica Group Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; Liliopsida; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_089035) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_034140825.1-RS_2024_06 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 06/21/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..2038 /organism="Oryza sativa Japonica Group" /mol_type="mRNA" /db_xref="taxon:39947" /chromosome="1" gene 1..2038 /gene="LOC9270848" /note="uncharacterized LOC9270848; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 6 long SRA reads, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 104 samples with support for all annotated introns" /db_xref="GeneID:9270848" misc_feature 1 /gene="LOC9270848" /experiment="COORDINATES: cap analysis [ECO:0007248]" /note="transcription start site" CDS 1224..1643 /gene="LOC9270848" /codon_start=1 /product="uncharacterized protein isoform X3" /protein_id="XP_066167754.1" /db_xref="GeneID:9270848" /translation="
MNFGADTSRELGARSSEKAARWIRTMESALKPPRKDELVSCSHTRWQAFRLSRCSNRMHSIGWTVFSSVHNDPMASDVIAPSPWTIFDCKNGKRWWFRGEGNSCMKQRLHILLMTILARSVLPWVPWSLIICLILSMLV"
polyA_site 2038 /gene="LOC9270848" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN
gtctctctctcaccctctccctccgctctctcgccgccgtcgccgccacgcgctgccacctccgtctccccctcgcgccaccgcgtctactgccgccgccgccgccgcgtccaccgcagccgcctcgggcgggtccacctctcctccaccgccgcgtccacttccgccgccgtcgccgcgtccaccgcagccgccttcgccgcgtccacctccgccgccgccgcgtccaccgcagccgcctcggtcgcgtccacctctgctgccgccgcatccatttccgccgccgctgccgcgacgctgtctccgagcgccgtcgccatcatcgaggcgagcagccatctcgagcgccgccgctgccaagtgcctcctccggccgccggcgtccggatccggactccatgtggtcgggagacgtcgatctgaccggcggatgtgacgaggagctcggccgcgccacacggagctcaacctcggcggattgggcgacggcgtcggcctcggcggtgaaaagtctctgttgctgctgccgccgtcgggcagtcaaggtttttcctgccggtagagtatggaaaaagaatcttccatgtgctagggcaaggaagccttttgtagtcagctctctagacttgcttatgcttctgcagtgagcacccagcaataggtaaatctgctctcttggttctctgaattaaaaggacatacaactatagcatgatgatcttgcaggaaattatcatgtcttttcagcaagattgctctatatgaatcgagttgtcgaaaaaggtgccatttagtccacgggcttcacgaaaatcagtgtttcaaagaaacaaaccttgaaacattccatggggttctcagatcgcggatggcggcggccaccaggcggatgtggtcaagggaggactggcagcgctgagcaacgacgtctaggaatagcatctcaggtcagtcctcttgctccctcatctcgctccttacatatttctggattattcagttgaggagaaggaattcacaaaggaactgctcctgcacccactccccaatcgcaacgcgctggcccacttccactcctctgcgcatccctctgctgccaacggacgctagcaacatgtcaaaccccaaggccatcccccagctgtgcaagtcactgactttacggtattggagttcgagtagaagatcagctgctccgtcatcgacgatggcctgatccacagatgaattttggtgctgatacttccagggagttgggtgctcgaagttcagaaaaagctgctaggtggatcaggacaatggaatctgccttaaagcccccaagaaaggatgaacttgttagctgttcacatacaagatggcaagcttttaggctaagccgctgcagtaaccgcatgcactcaataggttggactgtattttcttctgtccataacgatcctatggcatctgatgttattgcaccttctccatggacaatatttgactgtaaaaatggcaaaagatggtggttcagaggggaaggtaattcttgtatgaaacaaaggttgcatatccttcttatgacgattctagcaaggtcggtattgccatgggtgccttggagcttaatcatttgcctgattctcagcatgcttgtctgaaaagcagattgacctgagtttgtgtggtaagtggaggtgtccctgcaaagtgaagtcctcggtttattccagcttccattacataggaggagccccattgatagcacatttgaaccggtggctcatgataaaccagttagttgactgaaggagctgctccatctgcttttctctttgatcatttagcatatcgatgcatacgaactatgaaggagctggtccatctgcttttttgtcgcaatgatctgtgtacatgccccctccttatctcttcgtctttaaggaataatgtagtttgatccaatggacgaatgagattgttttggttggatgtttacatcatcagaacgaacagaataactagatgtgttatgataaataccaattgttcttta
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]