2025-03-04 06:37:04, GGRNA.v2 : RefSeq release 228 (Jan, 2025)
LOCUS XM_066308190 363 bp mRNA linear PLN 10-JUL-2024 DEFINITION PREDICTED: Oryza sativa Japonica Group homeobox-leucine zipper protein HOX19-like (LOC136355511), mRNA. ACCESSION XM_066308190 VERSION XM_066308190.1 DBLINK BioProject: PRJNA1123306 KEYWORDS RefSeq; includes ab initio. SOURCE Oryza sativa Japonica Group (Japanese rice) ORGANISM Oryza sativa Japonica Group Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; Liliopsida; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_089035) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_034140825.1-RS_2024_06 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 06/21/2024 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 100% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..363 /organism="Oryza sativa Japonica Group" /mol_type="mRNA" /db_xref="taxon:39947" /chromosome="1" gene 1..363 /gene="LOC136355511" /note="homeobox-leucine zipper protein HOX19-like; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins" /db_xref="GeneID:136355511" CDS 1..363 /gene="LOC136355511" /codon_start=1 /product="homeobox-leucine zipper protein HOX19-like" /protein_id="XP_066164287.1" /db_xref="GeneID:136355511" /translation="
MEEKEEMTMLSLGVGAASKHSISNRKFRLKEVTDHKFNLGDQDHNSGHVRKKLRLSEEQLTVLENMYEAGSNLDQALKQGLAEKLNIKPRQVEVWFQNRRARTKHKQIEEECKNRGGWRA"
misc_feature <28..258 /gene="LOC136355511" /note="Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF). Typically, the vWA domain is made up of approximately 200 amino acid residues folded into a classic a/b para-rossmann type of...; Region: vWFA; cl00057" /db_xref="CDD:469594" misc_feature 148..315 /gene="LOC136355511" /note="Region: Homeodomain; pfam00046" /db_xref="CDD:459649" ORIGIN
atggaagaaaaggaggaaatgaccatgctttcccttggagttggagctgctagcaagcactcaatatccaacagaaaattcagactgaaagaagtgacagatcacaaattcaaccttggagatcaagatcataacagtggccatgtgaggaagaagctaaggcttagcgaagaacaattgactgtgctggaaaatatgtatgaagctggcagcaatctcgaccaagcactaaaacaagggcttgcggagaagctgaacataaaaccacgccaagttgaagtctggtttcagaacagaagagcccggaccaaacataagcagatcgaagaagaatgcaagaaccgaggtggttggagggcctaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]