GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-19 02:46:56, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_015777723            1437 bp    mRNA    linear   PLN 07-AUG-2018
DEFINITION  PREDICTED: Oryza sativa Japonica Group protein argonaute 12-like
            (LOC107278545), transcript variant X3, mRNA.
ACCESSION   XM_015777723
VERSION     XM_015777723.2
DBLINK      BioProject: PRJNA122
KEYWORDS    RefSeq.
SOURCE      Oryza sativa Japonica Group (Japanese rice)
  ORGANISM  Oryza sativa Japonica Group
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; Liliopsida; Poales; Poaceae; BOP
            clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_029258.1) annotated using gene prediction method: Gnomon,
            supported by EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Aug 7, 2018 this sequence version replaced XM_015777723.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Oryza sativa Japonica Group
                                           Annotation Release 102
            Annotation Version          :: 102
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.1
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1437
                     /organism="Oryza sativa Japonica Group"
                     /mol_type="mRNA"
                     /cultivar="Nipponbare"
                     /db_xref="taxon:39947"
                     /chromosome="3"
     gene            1..1437
                     /gene="LOC107278545"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 3 ESTs, and 84% coverage of the
                     annotated genomic feature by RNAseq alignments, including
                     4 samples with support for all annotated introns"
                     /db_xref="GeneID:107278545"
     CDS             121..822
                     /gene="LOC107278545"
                     /codon_start=1
                     /product="protein argonaute 12-like isoform X3"
                     /protein_id="XP_015633209.1"
                     /db_xref="GeneID:107278545"
                     /translation="
MYVVSDCTYPLCQKSQRFFGAHTIHYDLGEDSEAGVDSEGIASVAASLDWPKFRKYHTLISHQPHNGIINLHSRRGGMMTKFFRSFYKMIKERPKRIIFYRGGLMEGEMERICLQEIDAIKQACAYSYKEDQPSLTYVVVVPTASIGTEADTAKYKFFCRHTTHKSTSRVVRYHVVHDDNNFLAGELQSLTLKLFTFRHRREYPKIDAVVPAYYAERAAFKAYRAECAASKAS"
     misc_feature    <172..786
                     /gene="LOC107278545"
                     /note="PIWI domain. Domain found in proteins involved in
                     RNA silencing. RNA silencing refers to a group of related
                     gene-silencing mechanisms mediated by short RNA molecules,
                     including siRNAs, miRNAs, and heterochromatin-related
                     guide RNAs. The central component...; Region: Piwi-like;
                     cl00628"
                     /db_xref="CDD:412485"
     misc_feature    order(184..186,190..192,424..426,766..768)
                     /gene="LOC107278545"
                     /note="active site"
                     /db_xref="CDD:239208"
ORIGIN      
gggaaattgaagagatgtgtgagagccttagaattgtttatgttttctgtttaccctgcctaagcaaacggaatctgaagagagttgcacgccaaatacaattgaaggttgtaaagagttatgtacgtcgtcagcgactgcacttaccccttgtgtcagaagtcccaacgattttttggtgctcacacgatacactatgatcttggagaggattcagaggcaggagtggattcagagggcattgcatctgtggcggcttcattggactggccaaaattcagaaagtatcatacattaatttcacatcaacctcataatggcatcataaatctccattctagacgtggtggcatgatgaccaagttctttcggtccttctacaaaatgataaaagaaagacccaagaggataatcttctacagaggtggattaatggaaggtgagatggagcgcatttgcctgcaagaaatagatgctattaaacaggcttgtgcctattcctacaaagaagatcaaccatcactgacatatgtggtcgtggtgcctactgcatcaattggaactgaggctgacaccgctaagtataagttcttttgccgccatactactcataagtcaacctcccgcgtggtccgctaccacgttgtccatgacgacaacaactttctagctggtgaacttcagtctctaaccttgaagcttttcaccttccgtcatcgtcgggaatacccaaagatagatgcagttgtaccggcctactacgcagagcgtgctgcattcaaagcttatcgcgcagagtgtgctgcatccaaagcttcttaagaagagcaaagcgagatgagaatgttgctactctagcaaaaattaatcagatgtttatctaacttattaagatgtctggtgtattttgaactcaaaaacgagtgtgcatatggtaacctgttaccgctgttgatcagacgtgttatggcgcttgtttttgttaatagttcaatgctgcgggttttgaaattgcatgtagtattggtcttttttaagacagaacaatccttgtacattttcaaatttaatatttatatatatcatgatttgaatggaagtactatctccattccaaaatatagcaatattttttctatgtatttggatataacattgtcctaatagcttgaagtagttatatttttttgtgctgaacatggacgcgttgcacgtgctccggttgtccggcacaaatccatcgtctccgcctgtggtgttcgataggcagcgctttcagtttggttaatatggctgctcaggttggatttgcaaggaaggagcgattgggtaagatgaaacctggaaacgatttgtgccgatttgagaatttggggtcttttcgccatttgcgcaaccaatctacactaaaaaaaagaatataaatccaccagaaag
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]