LOCUS       XM_015765258            1887 bp    mRNA    linear   PLN 10-JUL-2024
DEFINITION  PREDICTED: Oryza sativa Japonica Group uncharacterized protein
            (LOC9266982), mRNA.
ACCESSION   XM_015765258
VERSION     XM_015765258.3
DBLINK      BioProject: PRJNA1123306
KEYWORDS    RefSeq.
SOURCE      Oryza sativa Japonica Group (Japanese rice)
  ORGANISM  Oryza sativa Japonica Group
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; Liliopsida; Poales; Poaceae; BOP
            clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_089046) annotated using gene prediction method: Gnomon,
            supported by mRNA and EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Jul 10, 2024 this sequence version replaced XM_015765258.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_034140825.1-RS_2024_06
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 06/21/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1887
                     /organism="Oryza sativa Japonica Group"
                     /mol_type="mRNA"
                     /db_xref="taxon:39947"
                     /chromosome="12"
     gene            1..1887
                     /gene="LOC9266982"
                     /note="uncharacterized LOC9266982; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     mRNA, 13 ESTs, 1456 long SRA reads, 16 Proteins, and 100%
                     coverage of the annotated genomic feature by RNAseq
                     alignments, including 106 samples with support for all
                     annotated introns"
                     /db_xref="GeneID:9266982"
     misc_feature    1
                     /gene="LOC9266982"
                     /experiment="COORDINATES: cap analysis [ECO:0007248]"
                     /note="transcription start site"
     CDS             128..1594
                     /gene="LOC9266982"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_015620744.1"
                     /db_xref="GeneID:9266982"
                     /translation="

MEGPKRSQLRVRLRVTARRRGGDGGADGGGSGGGGGGAGGRKRLLDAPAFNSAAKLQRREIGGRQLAARGGGAASAVPERFRNMHLQEEFDTYDHNAHLFVKLQFLKKRSKIIEIVAAKDIIFALAHSGLCAAFSRVTNKRISFLNLSPDEVIRSLFYNKNNDSLITVSVYASDHFSTLKCRTTPIEYIRRNQLDAGFPLFETESLKWPGFVEFDDVNGKVLTYSAQDGIYKVFDLKNYSFLYSIPDTNVQEIKISPGIMLLIYERTPCHVPLKILSIEDGRPLKSFTHLLHRNKKIDFIEQFNEKLLVKQEDENLQILDVRSSELIEVSVTKFMTPSAFIFLYENNLFLTFRNRTVAVWNFRGELVTSFEDHLLWHQDCSTNNIYITSDQDLIISYCKSEAGVDDGTVPPIGSINMSDIMTGKCIAKIAANDPTLRIGPRKNGNSERSSIWSTIPEALEDVTALFYDEDRNEIYTGNRHGLVHVWSN"

     misc_feature    761..1588
                     /gene="LOC9266982"
                     /note="WD40 domain, found in a number of eukaryotic
                     proteins that cover a wide variety of functions including
                     adaptor/regulatory modules in signal transduction,
                     pre-mRNA processing and cytoskeleton assembly; typically
                     contains a GH dipeptide 11-24 residues from...; Region:
                     WD40; cl29593"
                     /db_xref="CDD:475233"
     misc_feature    order(794..796,809..811,827..832,863..865,920..922,
                     953..958,992..994,1001..1003,1052..1054,1064..1066,
                     1082..1087,1124..1126,1178..1180,1187..1189,1205..1210,
                     1241..1246,1313..1315,1343..1345,1379..1384,1424..1426,
                     1442..1447,1496..1501,1553..1555,1565..1567,1583..1588)
                     /gene="LOC9266982"
                     /note="structural tetrad [active]"
                     /db_xref="CDD:238121"
     polyA_site      1887
                     /gene="LOC9266982"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      

accaccaaattccccctcaaaccctagctagctccacctcctcctcctccttcgaaaccctagcctcaccaccccccgccacgagggaggagcgagcggcgcagtggtggacggcggcggcggcgggatggaggggcccaagaggtcgcagctgagggtgcggctccgcgtgacggcgcggcggaggggcggcgacggcggcgcggacggcggagggagcgggggcggaggcggcggggccgggggcaggaagcggctgctggacgcgccggccttcaactcggccgcgaagctgcagcggcgcgagatcgggggcaggcagctcgccgcgcgcggcgggggcgccgcgtccgccgtgcccgagcggttccggaacatgcatctccaggaagagttcgatacgtatgatcacaatgcccacctatttgtgaagctgcagtttcttaaaaagagatccaaaataattgagattgttgcagcaaaagatatcatatttgctcttgcgcactctgggttgtgtgctgcttttagtcgagttacaaataagcgcatatccttcctgaatttaagcccagatgaagtcatccggagcttgttctacaacaagaacaatgattcacttattactgtgtctgtttatgcgtcagaccattttagcacattgaagtgcagaacaaccccaatcgagtatataaggaggaatcagttagatgctgggtttcctctttttgaaacagaatctctgaagtggcctggctttgtggagtttgatgatgtgaatggaaaagtactcacctactcagctcaggatggtatctataaggtcttcgatttgaagaattactcttttctatattcaatacctgacaccaatgtgcaggagataaaaataagtccaggaatcatgctcttgatatatgaaagaacaccatgtcatgttcctttgaagatattgtcaattgaagatggaagaccactaaaatccttcacgcatttgttgcaccgtaataagaaaattgattttatcgagcaattcaatgaaaagctccttgtcaagcaagaagatgagaaccttcagatacttgatgtacggagttctgagctaattgaagtcagtgttaccaagtttatgactccatcagcattcatttttctgtacgagaacaatctcttcttgacattccgaaacaggacggttgctgtatggaattttcgaggagagctcgtgacctcatttgaagaccatttgctttggcatcaagattgtagcaccaacaatatctacattaccagtgatcaggatctgattatctcatactgcaaatctgaggcaggggttgatgatggtacagtacctccaattgggtctatcaacatgagtgacattatgactggcaaatgcatcgccaagattgctgctaatgatcccaccctccgtattggccctcgcaagaatggtaactctgagaggtcctcaatttggagcaccattccagaagctcttgaagatgtcacagcgcttttttatgacgaggacaggaatgagatctatactggcaacaggcatgggctggtgcatgtgtggtccaactaggttgtaatatgtatatgtacatacgcccttttcgatttgaccagaagattggattagccattgtgcaccatcatcccctgcctggtgatcaccttagtttttgtatttttggtcttttggcaaagaatgttattcccttgtcagtcaagagaaaaatgtagttaccctgtatatatcttttgtaatgccctgtcatataccatgttcttggcagctggcctctctgtcccaaccacgaaacatctggcaggaaccatctaactaattaagcttctcattcctttcggtgttta

//