ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2026-06-27 19:19:07, GGRNA.v2 : RefSeq release 233 (Jan, 2026)
LOCUS NM_029636 1330 bp mRNA linear ROD 20-JAN-2026
DEFINITION Mus musculus cathepsin Q (Ctsq), mRNA.
ACCESSION NM_029636
VERSION NM_029636.3
KEYWORDS RefSeq; RefSeq Select.
SOURCE Mus musculus (house mouse)
ORGANISM Mus musculus
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE 1 (bases 1 to 1330)
AUTHORS Viscomi,M.P., Zietek,M.M. and Sampino,S.
TITLE Embryonic and placental factors are linked with the development of
autism-like behaviors in the BTBR mouse model
JOURNAL Neuroscience 593, 18-28 (2026)
PUBMED 41354143
REFERENCE 2 (bases 1 to 1330)
AUTHORS Zheng,W., Zhang,Y., Xu,P., Wang,Z., Shao,X., Chen,C., Cai,H.,
Wang,Y., Sun,M.A., Deng,W., Liu,F., Lu,J., Zhang,X., Cheng,D.,
Mysorekar,I.U., Wang,H., Wang,Y.L., Hu,X. and Cao,B.
TITLE TFEB safeguards trophoblast syncytialization in humans and mice
JOURNAL Proc Natl Acad Sci U S A 121 (28), e2404062121 (2024)
PUBMED 38968109
REFERENCE 3 (bases 1 to 1330)
AUTHORS Lee,J.G., Yon,J.M., Kim,G., Lee,S.G., Kim,C.Y., Cheong,S.A.,
Kim,H.Y., Yu,J., Kim,K., Sung,Y.H., Yoo,H.J., Woo,D.C., Rho,J.K.,
Ha,C.H., Pack,C.G., Oh,S.H., Lim,J.S., Han,Y.M., Hong,E.J.,
Seong,J.K., Lee,H.W., Lee,S.W., Lee,K.U., Kim,C.J., Nam,S.Y.,
Cho,Y.S. and Baek,I.J.
TITLE PIBF1 regulates trophoblast syncytialization and promotes
cardiovascular development
JOURNAL Nat Commun 15 (1), 1487 (2024)
PUBMED 38374152
REMARK Publication Status: Online-Only
REFERENCE 4 (bases 1 to 1330)
AUTHORS Astrof,S., Arriagada,C., Saijoh,Y., Francou,A., Kelly,R.G. and
Moon,A.
TITLE Aberrant differentiation of second heart field mesoderm prefigures
cellular defects in the outflow tract in response to loss of FGF8
JOURNAL Dev Biol 499, 10-21 (2023)
PUBMED 37060937
REFERENCE 5 (bases 1 to 1330)
AUTHORS Hiver,S., Shimizu-Mizuno,N., Ikawa,Y., Kajikawa,E., Sai,X.,
Nishimura,H., Takaoka,K., Nishimura,O., Kuraku,S., Tanaka,S. and
Hamada,H.
TITLE Gse1, a component of the CoREST complex, is required for placenta
development in the mouse
JOURNAL Dev Biol 498, 97-105 (2023)
PUBMED 37019373
REFERENCE 6 (bases 1 to 1330)
AUTHORS Simmons,D.G., Fortier,A.L. and Cross,J.C.
TITLE Diverse subtypes and developmental origins of trophoblast giant
cells in the mouse placenta
JOURNAL Dev Biol 304 (2), 567-578 (2007)
PUBMED 17289015
REFERENCE 7 (bases 1 to 1330)
AUTHORS Liu,P., Wang,Y., Vikis,H., Maciag,A., Wang,D., Lu,Y., Liu,Y. and
You,M.
TITLE Candidate lung tumor susceptibility genes identified through
whole-genome association analyses in inbred mice
JOURNAL Nat Genet 38 (8), 888-895 (2006)
PUBMED 16862160
REFERENCE 8 (bases 1 to 1330)
AUTHORS Ishida,M., Ono,K., Taguchi,S., Ohashi,S., Naito,J., Horiguchi,K.
and Harigaya,T.
TITLE Cathepsin gene expression in mouse placenta during the latter half
of pregnancy
JOURNAL J Reprod Dev 50 (5), 515-523 (2004)
PUBMED 15514457
REMARK GeneRIF: Possible association of cathepsins with placental
lactogen-II may play important roles in placental functions during
the latter half of pregnancy in mice.
REFERENCE 9 (bases 1 to 1330)
AUTHORS Deussing,J., Kouadio,M., Rehman,S., Werber,I., Schwinde,A. and
Peters,C.
TITLE Identification and characterization of a dense cluster of
placenta-specific cysteine peptidase genes and related genes on
mouse chromosome 13
JOURNAL Genomics 79 (2), 225-240 (2002)
PUBMED 11829493
REFERENCE 10 (bases 1 to 1330)
AUTHORS Sol-Church,K., Frenck,J. and Mason,R.W.
TITLE Cathepsin Q, a novel lysosomal cysteine protease highly expressed
in placenta
JOURNAL Biochem Biophys Res Commun 267 (3), 791-795 (2000)
PUBMED 10673370
COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final
NCBI review. The reference sequence was derived from AC160115.2.
On Mar 21, 2007 this sequence version replaced NM_029636.2.
Sequence Note: The RefSeq transcript and protein were derived from
genomic sequence to make the sequence consistent with the reference
genome assembly. The genomic coordinates used for the transcript
record were based on alignments.
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: AY014776.1, BC099415.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
SAMN01164134 [ECO:0000348]
##Evidence-Data-END##
##RefSeq-Attributes-START##
RefSeq Select criteria :: based on single protein-coding transcript
##RefSeq-Attributes-END##
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-33 AC160115.2 36727-36759 c
34-167 AC160115.2 35589-35722 c
168-290 AC160115.2 35191-35313 c
291-470 AC160115.2 34922-35101 c
471-695 AC160115.2 33834-34058 c
696-858 AC160115.2 33216-33378 c
859-973 AC160115.2 32337-32451 c
974-1330 AC160115.2 31200-31556 c
FEATURES Location/Qualifiers
source 1..1330
/organism="Mus musculus"
/mol_type="mRNA"
/strain="C57BL/6"
/db_xref="taxon:10090"
/chromosome="13"
/map="13 32.65 cM"
gene 1..1330
/gene="Ctsq"
/gene_synonym="1600010J02Rik"
/note="cathepsin Q"
/db_xref="GeneID:104002"
/db_xref="MGI:MGI:2137385"
exon 1..33
/gene="Ctsq"
/gene_synonym="1600010J02Rik"
/inference="alignment:Splign:2.1.0"
exon 34..167
/gene="Ctsq"
/gene_synonym="1600010J02Rik"
/inference="alignment:Splign:2.1.0"
misc_feature 36..38
/gene="Ctsq"
/gene_synonym="1600010J02Rik"
/note="upstream in-frame stop codon"
CDS 42..1073
/gene="Ctsq"
/gene_synonym="1600010J02Rik"
/codon_start=1
/product="cathepsin Q precursor"
/protein_id="NP_083912.2"
/db_xref="CCDS:CCDS26584.1"
/db_xref="GeneID:104002"
/db_xref="MGI:MGI:2137385"
/translation="
MTPAFFLVILCLGILSGVSAFDPSLDVEWKEWMGSFEKLYSPEEEVLRRAIWEENVKRIKLHNRENSLGKNTYTMGLNGFADMTDEEFMNIVIGATLPVDNTRKSLWKRALGSPFPKSWYWKDALPKFVDWRNEGYVTRVRNQRNCNSCWAFPVTGAIEGQMFKKTGKLIPLSVQNLVDCSRPQGNRGCRWGNTYNGFQYVLHNGGLEAQATYPYEGKEGLCRYNPKNSAAKITGFVVLPESEDVLMDAVATKGPIATGIHVVSSSFRFYDGGVYYEPNCTSSVNHAVLIIGYGYVGNETDGNNYWLIKNSWGRRWGLSGYMMIAKDRNNHCAIASLAQYPTV"
sig_peptide 42..101
/gene="Ctsq"
/gene_synonym="1600010J02Rik"
/inference="COORDINATES: ab initio prediction:SignalP:6.0"
misc_feature 126..305
/gene="Ctsq"
/gene_synonym="1600010J02Rik"
/note="Cathepsin propeptide inhibitor domain (I29);
Region: Inhibitor_I29; pfam08246"
/db_xref="CDD:462410"
misc_feature 414..1067
/gene="Ctsq"
/gene_synonym="1600010J02Rik"
/note="Papain family cysteine protease; Region:
Peptidase_C1; pfam00112"
/db_xref="CDD:425470"
misc_feature order(468..470,486..488,897..899,969..971)
/gene="Ctsq"
/gene_synonym="1600010J02Rik"
/note="active site"
/db_xref="CDD:239068"
misc_feature order(618..623,816..818,891..893,900..902,1050..1052)
/gene="Ctsq"
/gene_synonym="1600010J02Rik"
/note="S2 subsite [active]"
/db_xref="CDD:239068"
exon 168..290
/gene="Ctsq"
/gene_synonym="1600010J02Rik"
/inference="alignment:Splign:2.1.0"
exon 291..470
/gene="Ctsq"
/gene_synonym="1600010J02Rik"
/inference="alignment:Splign:2.1.0"
exon 471..695
/gene="Ctsq"
/gene_synonym="1600010J02Rik"
/inference="alignment:Splign:2.1.0"
exon 696..858
/gene="Ctsq"
/gene_synonym="1600010J02Rik"
/inference="alignment:Splign:2.1.0"
exon 859..973
/gene="Ctsq"
/gene_synonym="1600010J02Rik"
/inference="alignment:Splign:2.1.0"
exon 974..1330
/gene="Ctsq"
/gene_synonym="1600010J02Rik"
/inference="alignment:Splign:2.1.0"
ORIGIN
gtgatctgaggcagtagtggtcatcccagaaaggttgagacatgactcctgctttcttcctggtcatcctgtgcttgggaatcctgtcaggtgtttcagcatttgatcccagtttggatgtcgaatggaaagagtggatgggaagctttgaaaaattatacagtccggaggaagaagtactgagaagagcaatatgggaagaaaatgtaaaaaggattaaactgcataacagggagaattccctagggaagaatacctacaccatgggattaaatgggtttgctgacatgactgatgaagaattcatgaacattgtaattggtgctacattgccagttgacaacacaagaaaaagtctctggaaacgtgcacttggtagtccttttcctaaatcttggtattggaaagatgctttgcccaaatttgttgattggcgaaatgaaggctatgtgactcgtgtgaggaatcagagaaattgtaattcttgttgggcttttcctgtgactggtgccatagaaggacaaatgttcaagaaaacaggcaaactgatcccactgagtgtacagaacctagtggactgttctaggcctcaaggcaatagaggctgtcgttggggtaatacatacaatggattccagtacgttttgcacaatggaggtctggaggctcaggcaacctatccttatgaaggaaaagaaggactatgcaggtacaatcctaaaaattctgctgctaaaatcacaggatttgtggtcctcccagaaagtgaagatgtcctcatggatgctgtagcaactaaaggccccattgctactggaattcatgttgtctccagtagttttaggttctatgatggaggtgtttattatgaaccaaattgcacaagttctgtgaatcatgcagttttgataattggctatggttatgtgggaaatgaaacggatggcaataattactggctgatcaagaacagctggggtagacgatggggattgagtggatatatgatgattgccaaagacaggaacaaccactgtgcaattgcttcattggcccaataccctactgtgtgagcaccctgatgttcacaagaaagcatgtggcatgagactctatttccagaggagtgccatccactccaatgaacagactttattgactatgttaaactcttgagtcccacaaaatccacattgtaatgtgaattctgggagctttcaaatatttcacatgagtactgtaacttttgctttcactactgaatgctcatgttttctaaagtaactttattttcacttttaatgtttgtgcaaataaaatccttaaaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]