LOCUS       NM_023878               1200 bp    mRNA    linear   ROD 16-OCT-2024
DEFINITION  Mus musculus claudin 10 (Cldn10), transcript variant a, mRNA.
ACCESSION   NM_023878
VERSION     NM_023878.3
KEYWORDS    RefSeq.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 1200)
  AUTHORS   Patel,V.N., Aure,M.H., Choi,S.H., Ball,J.R., Lane,E.D., Wang,Z.,
            Xu,Y., Zheng,C., Liu,X., Martin,D., Pailin,J.Y., Prochazkova,M.,
            Kulkarni,A.B., van Kuppevelt,T.H., Ambudkar,I.S., Liu,J. and
            Hoffman,M.P.
  TITLE     Specific 3-O-sulfated heparan sulfate domains regulate salivary
            gland basement membrane metabolism and epithelial differentiation
  JOURNAL   Nat Commun 15 (1), 7584 (2024)
   PUBMED   39217171
  REMARK    Erratum:[Nat Commun. 2024 Oct 10;15(1):8784. doi:
            10.1038/s41467-024-53230-4. PMID: 39389981]
            Publication Status: Online-Only
REFERENCE   2  (bases 1 to 1200)
  AUTHORS   Brideau,G., Cheval,L., Griveau,C., Ling,W.E., Lievre,L.,
            Crambert,G., Muller,D., Brocic,J., Cherchame,E., Houillier,P. and
            Prot-Bertoye,C.
  TITLE     Claudin-10 Expression and the Gene Expression Pattern of Thick
            Ascending Limb Cells
  JOURNAL   Int J Mol Sci 25 (7), 4008 (2024)
   PUBMED   38612818
  REMARK    GeneRIF: Claudin-10 Expression and the Gene Expression Pattern of
            Thick Ascending Limb Cells.
            Publication Status: Online-Only
REFERENCE   3  (bases 1 to 1200)
  AUTHORS   Aure,M.H., Symonds,J.M., Villapudua,C.U., Dodge,J.T., Werner,S.,
            Knosp,W.M. and Hoffman,M.P.
  TITLE     FGFR2 is essential for salivary gland duct homeostasis and
            MAPK-dependent seromucous acinar cell differentiation
  JOURNAL   Nat Commun 14 (1), 6485 (2023)
   PUBMED   37838739
  REMARK    Publication Status: Online-Only
REFERENCE   4  (bases 1 to 1200)
  AUTHORS   Winningham,A.H. and Camper,S.A.
  TITLE     Pituitary Stem Cell Regulation by Zeb2 and BMP Signaling
  JOURNAL   Endocrinology 164 (3) (2023)
   PUBMED   36683433
REFERENCE   5  (bases 1 to 1200)
  AUTHORS   Quintanova,C., Himmerkus,N., Svendsen,S.L., von Schwerdtner,O.,
            Merkel,C., Pinckert,L., Mutig,K., Breiderhoff,T., Muller,D.,
            Gunzel,D. and Bleich,M.
  TITLE     Unrecognized role of claudin-10b in basolateral membrane infoldings
            of the thick ascending limb
  JOURNAL   Ann N Y Acad Sci 1517 (1), 266-278 (2022)
   PUBMED   35996827
  REMARK    GeneRIF: Unrecognized role of claudin-10b in basolateral membrane
            infoldings of the thick ascending limb.
REFERENCE   6  (bases 1 to 1200)
  AUTHORS   Kitajiri,S.I., Furuse,M., Morita,K., Saishin-Kiuchi,Y., Kido,H.,
            Ito,J. and Tsukita,S.
  TITLE     Expression patterns of claudins, tight junction adhesion molecules,
            in the inner ear
  JOURNAL   Hear Res 187 (1-2), 25-34 (2004)
   PUBMED   14698084
  REMARK    GeneRIF: Claudin-10 is expressed at the variety of epithelial
            tissues in the coclea of inner ear including Organ of Corti, stria
            vascularis, Reissner's membrane, and spiral limbus.
REFERENCE   7  (bases 1 to 1200)
  AUTHORS   VanBuren,V., Piao,Y., Dudekula,D.B., Qian,Y., Carter,M.G.,
            Martin,P.R., Stagg,C.A., Bassey,U.C., Aiba,K., Hamatani,T.,
            Kargul,G.J., Luo,A.G., Kelso,J., Hide,W. and Ko,M.S.
  TITLE     Assembly, verification, and initial annotation of the NIA mouse
            7.4K cDNA clone set
  JOURNAL   Genome Res 12 (12), 1999-2003 (2002)
   PUBMED   12466305
REFERENCE   8  (bases 1 to 1200)
  AUTHORS   Turksen,K. and Troy,T.C.
  TITLE     Permeability barrier dysfunction in transgenic mice overexpressing
            claudin 6
  JOURNAL   Development 129 (7), 1775-1784 (2002)
   PUBMED   11923212
REFERENCE   9  (bases 1 to 1200)
  AUTHORS   Niimi,T., Nagashima,K., Ward,J.M., Minoo,P., Zimonjic,D.B.,
            Popescu,N.C. and Kimura,S.
  TITLE     claudin-18, a novel downstream target gene for the T/EBP/NKX2.1
            homeodomain transcription factor, encodes lung- and
            stomach-specific isoforms through alternative splicing
  JOURNAL   Mol Cell Biol 21 (21), 7380-7390 (2001)
   PUBMED   11585919
REFERENCE   10 (bases 1 to 1200)
  AUTHORS   Morita,K., Sasaki,H., Fujimoto,K., Furuse,M. and Tsukita,S.
  TITLE     Claudin-11/OSP-based tight junctions of myelin sheaths in brain and
            Sertoli cells in testis
  JOURNAL   J Cell Biol 145 (3), 579-588 (1999)
   PUBMED   10225958
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from CA467408.1, AK020131.1,
            CK332009.1 and AI851016.1.
            
            On May 12, 2009 this sequence version replaced NM_023878.2.
            
            Summary: This intronless gene encodes a member of the claudin
            family. Claudins are integral membrane proteins and components of
            tight unction strands. Tight junction strands serve as a physical
            barrier to prevent solutes and water from passing freely through
            the paracellular space between epithelial or endothelial cell
            sheets, and also play critical roles in maintaining cell polarity
            and signal transductions. Six alternatively spliced transcript
            variants have been identified, which encode different isoforms with
            distinct electric charge of the first extracellular loop and with
            or without the fourth transmembrane region. These isoforms exhibit
            distinct localization and function in paracellular anion or cation
            permeability. [provided by RefSeq, Aug 2010].
            
            Transcript Variant: This variant (a) represents the longest
            transcript and encodes isoform a, which is predicted to span the
            membrane four times with a structure of two extracellular loops,
            four transmembrane regions and a cytoplasmic tail. This variant is
            expressed only in kidney and uterus.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AK020131.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN00849385 [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-37                CA467408.1         38-74
            38-589              AK020131.1         2-553
            590-1001            CK332009.1         155-566
            1002-1200           AI851016.1         1-199               c
FEATURES             Location/Qualifiers
     source          1..1200
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="C57BL/6"
                     /db_xref="taxon:10090"
                     /chromosome="14"
                     /map="14 62.55 cM"
     gene            1..1200
                     /gene="Cldn10"
                     /gene_synonym="6720456I16Rik; Cldn10a; Cldn10b;
                     D14Ertd728e"
                     /note="claudin 10"
                     /db_xref="GeneID:58187"
                     /db_xref="MGI:MGI:1913101"
     exon            1..500
                     /gene="Cldn10"
                     /gene_synonym="6720456I16Rik; Cldn10a; Cldn10b;
                     D14Ertd728e"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    197..199
                     /gene="Cldn10"
                     /gene_synonym="6720456I16Rik; Cldn10a; Cldn10b;
                     D14Ertd728e"
                     /note="upstream in-frame stop codon"
     CDS             287..976
                     /gene="Cldn10"
                     /gene_synonym="6720456I16Rik; Cldn10a; Cldn10b;
                     D14Ertd728e"
                     /note="isoform a is encoded by transcript variant a;
                     claudin-10A; claudin 10B"
                     /codon_start=1
                     /product="claudin-10 isoform a"
                     /protein_id="NP_076367.2"
                     /db_xref="CCDS:CCDS37009.1"
                     /db_xref="GeneID:58187"
                     /db_xref="MGI:MGI:1913101"
                     /translation="

MSRAQISALVCGVGGFGALVAATTSNEWKVTTRASSVITATWVYQGLWMNCAGNALGSFHCRPHFTIFKVEGYIQACRGLMIAAVSLGFFGSIFALFGMKCTKVGGSDQAKAKIACLAGIVFILSGLCSMTGCSLYANKITTEFFDPLYMEQKYELGAALFIGWAGASLCIIGGVIFCFSISDNNKTPRMGYTYNGPTSAMSSRTKYQGGEGDFKTTGPSKQFDKNAYV"

     misc_feature    311..817
                     /gene="Cldn10"
                     /gene_synonym="6720456I16Rik; Cldn10a; Cldn10b;
                     D14Ertd728e"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; cl21598"
                     /db_xref="CDD:473919"
     exon            501..662
                     /gene="Cldn10"
                     /gene_synonym="6720456I16Rik; Cldn10a; Cldn10b;
                     D14Ertd728e"
                     /inference="alignment:Splign:2.1.0"
     exon            663..744
                     /gene="Cldn10"
                     /gene_synonym="6720456I16Rik; Cldn10a; Cldn10b;
                     D14Ertd728e"
                     /inference="alignment:Splign:2.1.0"
     exon            745..852
                     /gene="Cldn10"
                     /gene_synonym="6720456I16Rik; Cldn10a; Cldn10b;
                     D14Ertd728e"
                     /inference="alignment:Splign:2.1.0"
     exon            853..1186
                     /gene="Cldn10"
                     /gene_synonym="6720456I16Rik; Cldn10a; Cldn10b;
                     D14Ertd728e"
                     /inference="alignment:Splign:2.1.0"
     regulatory      1084..1089
                     /regulatory_class="polyA_signal_sequence"
                     /gene="Cldn10"
                     /gene_synonym="6720456I16Rik; Cldn10a; Cldn10b;
                     D14Ertd728e"
                     /note="hexamer: TATAAA"
     polyA_site      1104
                     /gene="Cldn10"
                     /gene_synonym="6720456I16Rik; Cldn10a; Cldn10b;
                     D14Ertd728e"
     regulatory      1168..1173
                     /regulatory_class="polyA_signal_sequence"
                     /gene="Cldn10"
                     /gene_synonym="6720456I16Rik; Cldn10a; Cldn10b;
                     D14Ertd728e"
                     /note="hexamer: AATAAA"
     polyA_site      1186
                     /gene="Cldn10"
                     /gene_synonym="6720456I16Rik; Cldn10a; Cldn10b;
                     D14Ertd728e"
                     /note="major polyA site"
ORIGIN      

aacaagagaaaaaaatatctgcagtaccaacaccttcaagattcctctacaaagttttggtatttcagtagggaattagaaagattattctaagctatctctaagatgcccttagtgtgatatactttattctaatttcccacacttcaagccatgagattatgaagaattgtcacctaccctcatgggctggctttaacattcgtggaagttttgtccagtgtctgcatgcctaggccaccaaagccttctgtgtggactgtggcagcaggcaaggctgagcgacatgtccagggcacagatctcagctctggtgtgtggtgttggagggtttggtgctctcgtcgctgccaccacatccaacgaatggaaagtgaccacccgagcgtcgtctgtgattaccgccacctgggtttaccagggtctgtggatgaactgcgcaggtaacgctctgggctccttccactgccggccacatttcactatcttcaaagtagaaggttacatccaggcatgtagaggactaatgatcgctgcggtcagcctgggatttttcggttccatttttgcactctttggaatgaaatgtaccaaagtcggaggctcagatcaagccaaagctaaaattgcttgcttggccgggattgtattcatattgtcaggtctgtgttccatgacaggctgttccctgtatgcaaacaaaatcacaacagaattctttgatcctctttatatggagcaaaagtatgaattaggggctgctctcttcatcggatgggcaggagcttctctctgcatcattgggggagtcatattttgcttttcaatatccgacaacaacaagacacccagaatgggctacacatacaacggacccacgtctgccatgtcttctcggaccaagtatcaaggcggagaaggagattttaaaaccacaggcccttcaaaacagtttgataaaaatgcctatgtctaaagagctctggcaagctgcctcctgagttttgttgtgcaagagaactgtcctcacaatagtccttccaaggctctcctgtaattactgcttaagctgttttttaaaaatataaatttgaagactgttaattggatgtaaatgttcttatagttatatactaatcattttctgctgtgcctttctgtaagggaaataaacaggttatttacaaaaaaaaaaaaaaa

//