LOCUS       NM_020504               1070 bp    mRNA    linear   ROD 04-OCT-2024
DEFINITION  Mus musculus claudin 13 (Cldn13), mRNA.
ACCESSION   NM_020504
VERSION     NM_020504.4
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 1070)
  AUTHORS   Adams,D.J., Barlas,B., McIntyre,R.E., Salguero,I., van der
            Weyden,L., Barros,A., Vicente,J.R., Karimpour,N., Haider,A.,
            Ranzani,M., Turner,G., Thompson,N.A., Harle,V., Olvera-Leon,R.,
            Robles-Espinoza,C.D., Speak,A.O., Geisler,N., Weninger,W.J.,
            Geyer,S.H., Hewinson,J., Karp,N.A., Fu,B., Yang,F., Kozik,Z.,
            Choudhary,J., Yu,L., van Ruiten,M.S., Rowland,B.D., Lelliott,C.J.,
            Del Castillo Velasco-Herrera,M., Verstraten,R., Bruckner,L.,
            Henssen,A.G., Rooimans,M.A., de Lange,J., Mohun,T.J., Arends,M.J.,
            Kentistou,K.A., Coelho,P.A., Zhao,Y., Zecchini,H., Perry,J.R.B.,
            Jackson,S.P. and Balmus,G.
  CONSRTM   Sanger Mouse Genetics Project
  TITLE     Genetic determinants of micronucleus formation in vivo
  JOURNAL   Nature 627 (8002), 130-136 (2024)
   PUBMED   38355793
REFERENCE   2  (bases 1 to 1070)
  AUTHORS   Higashi,A.Y., Higashi,T., Furuse,K., Ozeki,K., Furuse,M. and
            Chiba,H.
  TITLE     Claudin-9 constitutes tight junctions of folliculo-stellate cells
            in the anterior pituitary gland
  JOURNAL   Sci Rep 11 (1), 21642 (2021)
   PUBMED   34737342
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 1070)
  AUTHORS   Dickinson,M.E., Flenniken,A.M., Ji,X., Teboul,L., Wong,M.D.,
            White,J.K., Meehan,T.F., Weninger,W.J., Westerberg,H., Adissu,H.,
            Baker,C.N., Bower,L., Brown,J.M., Caddle,L.B., Chiani,F., Clary,D.,
            Cleak,J., Daly,M.J., Denegre,J.M., Doe,B., Dolan,M.E., Edie,S.M.,
            Fuchs,H., Gailus-Durner,V., Galli,A., Gambadoro,A., Gallegos,J.,
            Guo,S., Horner,N.R., Hsu,C.W., Johnson,S.J., Kalaga,S., Keith,L.C.,
            Lanoue,L., Lawson,T.N., Lek,M., Mark,M., Marschall,S., Mason,J.,
            McElwee,M.L., Newbigging,S., Nutter,L.M., Peterson,K.A.,
            Ramirez-Solis,R., Rowland,D.J., Ryder,E., Samocha,K.E.,
            Seavitt,J.R., Selloum,M., Szoke-Kovacs,Z., Tamura,M., Trainor,A.G.,
            Tudose,I., Wakana,S., Warren,J., Wendling,O., West,D.B., Wong,L.,
            Yoshiki,A., MacArthur,D.G., Tocchini-Valentini,G.P., Gao,X.,
            Flicek,P., Bradley,A., Skarnes,W.C., Justice,M.J., Parkinson,H.E.,
            Moore,M., Wells,S., Braun,R.E., Svenson,K.L., de Angelis,M.H.,
            Herault,Y., Mohun,T., Mallon,A.M., Henkelman,R.M., Brown,S.D.,
            Adams,D.J., Lloyd,K.C., McKerlie,C., Beaudet,A.L., Bucan,M. and
            Murray,S.A.
  CONSRTM   International Mouse Phenotyping Consortium; Jackson Laboratory;
            Infrastructure Nationale PHENOMIN, Institut Clinique de la Souris
            (ICS); Charles River Laboratories; MRC Harwell; Toronto Centre for
            Phenogenomics; Wellcome Trust Sanger Institute; RIKEN BioResource
            Center
  TITLE     High-throughput discovery of novel developmental phenotypes
  JOURNAL   Nature 537 (7621), 508-514 (2016)
   PUBMED   27626380
  REMARK    Erratum:[Nature. 2017 Nov 16;551(7680):398. doi:
            10.1038/nature24643. PMID: 29144450]
REFERENCE   4  (bases 1 to 1070)
  AUTHORS   Chakraborty,P., William Buaas,F., Sharma,M., Smith,B.E.,
            Greenlee,A.R., Eacker,S.M. and Braun,R.E.
  TITLE     Androgen-dependent sertoli cell tight junction remodeling is
            mediated by multiple tight junction components
  JOURNAL   Mol Endocrinol 28 (7), 1055-1072 (2014)
   PUBMED   24825397
  REMARK    GeneRIF: CLDN13 is a constituent of Sertoli cell tight junctions.
            CLDN13 is expressed throughout the seminiferous cycle and is
            localized to bicellular tight junctions.
REFERENCE   5  (bases 1 to 1070)
  AUTHORS   Koscielny,G., Yaikhom,G., Iyer,V., Meehan,T.F., Morgan,H.,
            Atienza-Herrero,J., Blake,A., Chen,C.K., Easty,R., Di Fenza,A.,
            Fiegel,T., Grifiths,M., Horne,A., Karp,N.A., Kurbatova,N.,
            Mason,J.C., Matthews,P., Oakley,D.J., Qazi,A., Regnart,J.,
            Retha,A., Santos,L.A., Sneddon,D.J., Warren,J., Westerberg,H.,
            Wilson,R.J., Melvin,D.G., Smedley,D., Brown,S.D., Flicek,P.,
            Skarnes,W.C., Mallon,A.M. and Parkinson,H.
  TITLE     The International Mouse Phenotyping Consortium Web Portal, a
            unified point of access for knockout mice and related phenotyping
            data
  JOURNAL   Nucleic Acids Res 42 (Database issue), D802-D809 (2014)
   PUBMED   24194600
REFERENCE   6  (bases 1 to 1070)
  AUTHORS   Abuazza,G., Becker,A., Williams,S.S., Chakravarty,S., Truong,H.T.,
            Lin,F. and Baum,M.
  TITLE     Claudins 6, 9, and 13 are developmentally expressed renal tight
            junction proteins
  JOURNAL   Am J Physiol Renal Physiol 291 (6), F1132-F1141 (2006)
   PUBMED   16774906
  REMARK    GeneRIF: developmentally expressed claudin isoforms include claudin
            6, claudin 9, and claudin 13
REFERENCE   7  (bases 1 to 1070)
  AUTHORS   Fujita,H., Chiba,H., Yokozaki,H., Sakai,N., Sugimoto,K., Wada,T.,
            Kojima,T., Yamashita,T. and Sawada,N.
  TITLE     Differential expression and subcellular localization of claudin-7,
            -8, -12, -13, and -15 along the mouse intestine
  JOURNAL   J Histochem Cytochem 54 (8), 933-944 (2006)
   PUBMED   16651389
REFERENCE   8  (bases 1 to 1070)
  AUTHORS   DeSilva,U., Elnitski,L., Idol,J.R., Doyle,J.L., Gan,W.,
            Thomas,J.W., Schwartz,S., Dietrich,N.L., Beckstrom-Sternberg,S.M.,
            McDowell,J.C., Blakesley,R.W., Bouffard,G.G., Thomas,P.J.,
            Touchman,J.W., Miller,W. and Green,E.D.
  TITLE     Generation and comparative analysis of approximately 3.3 Mb of
            mouse genomic sequence orthologous to the region of human
            chromosome 7q11.23 implicated in Williams syndrome
  JOURNAL   Genome Res 12 (1), 3-15 (2002)
   PUBMED   11779826
REFERENCE   9  (bases 1 to 1070)
  AUTHORS   Niimi,T., Nagashima,K., Ward,J.M., Minoo,P., Zimonjic,D.B.,
            Popescu,N.C. and Kimura,S.
  TITLE     claudin-18, a novel downstream target gene for the T/EBP/NKX2.1
            homeodomain transcription factor, encodes lung- and
            stomach-specific isoforms through alternative splicing
  JOURNAL   Mol Cell Biol 21 (21), 7380-7390 (2001)
   PUBMED   11585919
REFERENCE   10 (bases 1 to 1070)
  AUTHORS   Morita,K., Sasaki,H., Fujimoto,K., Furuse,M. and Tsukita,S.
  TITLE     Claudin-11/OSP-based tight junctions of myelin sheaths in brain and
            Sertoli cells in testis
  JOURNAL   J Cell Biol 145 (3), 579-588 (1999)
   PUBMED   10225958
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from BY079003.1 and AK010869.1.
            
            On Aug 11, 2010 this sequence version replaced NM_020504.3.
            
            Summary: This gene encodes a member of the claudin family. Claudins
            are integral membrane proteins and components of tight junction
            strands. Tight junction strands serve as a physical barrier to
            prevent solutes and water from passing freely through the
            paracellular space between epithelial or endothelial cell sheets,
            and also play critical roles in maintaining cell polarity and
            signal transductions. The protein encoded by this gene is a
            developmentally expressed renal tight junction protein. This gene
            is expressed in the cecum, colon, liver and kidney of mice, but is
            not identified in rat tissues. Humans and chimpanzees lack this
            gene. [provided by RefSeq, Aug 2010].
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AF516681.2, BY710282.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN01164135, SAMN01164140
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-4                 BY079003.1         2-5
            5-1070              AK010869.1         1-1066
FEATURES             Location/Qualifiers
     source          1..1070
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="C57BL/6"
                     /db_xref="taxon:10090"
                     /chromosome="5"
                     /map="5 74.88 cM"
     gene            1..1070
                     /gene="Cldn13"
                     /gene_synonym="2500004B14Rik"
                     /note="claudin 13"
                     /db_xref="GeneID:57255"
                     /db_xref="MGI:MGI:1913102"
     exon            1..829
                     /gene="Cldn13"
                     /gene_synonym="2500004B14Rik"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    196..198
                     /gene="Cldn13"
                     /gene_synonym="2500004B14Rik"
                     /note="upstream in-frame stop codon"
     CDS             202..837
                     /gene="Cldn13"
                     /gene_synonym="2500004B14Rik"
                     /codon_start=1
                     /product="claudin-13"
                     /protein_id="NP_065250.1"
                     /db_xref="CCDS:CCDS39314.1"
                     /db_xref="GeneID:57255"
                     /db_xref="MGI:MGI:1913102"
                     /translation="

MVVSKQEAISFSVTSLGWVGAIVSCVLPVWRVTFPDDETDPDATIWEGLWHICQVRENRWIQCTLYDTRILVAQDIKVSRVFMVICTIGTWLGLLLCVLGDWRINCFMNFTIEENLLKVAGGMFLSVGLLMLVPLSWVTHNIIHGFFNPLLGFSKKVQMGSSLSLAWTSSLLLLLGGILLCVNIPVCRDFPRCIETPSARPSGANNDTLDV"

     misc_feature    226..717
                     /gene="Cldn13"
                     /gene_synonym="2500004B14Rik"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; cl21598"
                     /db_xref="CDD:473919"
     misc_feature    226..288
                     /gene="Cldn13"
                     /gene_synonym="2500004B14Rik"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9Z0S4.1);
                     transmembrane region"
     misc_feature    442..504
                     /gene="Cldn13"
                     /gene_synonym="2500004B14Rik"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9Z0S4.1);
                     transmembrane region"
     misc_feature    556..618
                     /gene="Cldn13"
                     /gene_synonym="2500004B14Rik"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9Z0S4.1);
                     transmembrane region"
     misc_feature    697..759
                     /gene="Cldn13"
                     /gene_synonym="2500004B14Rik"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9Z0S4.1);
                     transmembrane region"
     exon            830..1070
                     /gene="Cldn13"
                     /gene_synonym="2500004B14Rik"
                     /inference="alignment:Splign:2.1.0"
     regulatory      1049..1054
                     /regulatory_class="polyA_signal_sequence"
                     /gene="Cldn13"
                     /gene_synonym="2500004B14Rik"
                     /note="hexamer: AATAAA"
     polyA_site      1069
                     /gene="Cldn13"
                     /gene_synonym="2500004B14Rik"
                     /note="major polyA site"
ORIGIN      

agatagggtcctgtgtcaactgctgtgctcacacttgctggagctcgacatttgactacctagatcatcattggtgacagtggcctctcatacgtgctggcccccgatactttaaaattccatcctcggctcttggaatcctgcatctctacagctggacccctgactcgtcctggtcctgccattagcagactctgagccatggtcgtcagcaaacaagaggccatcagcttctctgtgacttcactgggttgggtgggtgccattgtgagctgcgtgctgcccgtttggagggtgacctttccagatgatgagacagacccagatgccaccatttgggagggtctgtggcacatatgccaggttcgggaaaacaggtggatacagtgtacactgtatgacacccggatactggtagcacaggacataaaagtgtctcgagtctttatggtcatctgtaccattggaacctggctgggattgctgctctgtgtgcttggggattggcgcatcaattgtttcatgaattttactattgaagagaacctcttgaaagtagccggtgggatgtttcttagtgttggccttctgatgctggtacccctgtcctgggtaacacacaacatcatccatggcttctttaacccattgcttggcttctcgaagaaagtacagatgggctcttcactctccctggcctggaccagctccctgctgctgttgctgggaggcatcctgctctgtgtcaacatcccagtatgcagagactttccccgttgcattgagacccctagtgctagaccttcaggagccaacaacgataccttagatgtttgatggccagcacactcacgtctggaggggaaaacttcctcaagaggcctctctccaggttctagaatcattgaactggagggaggaaagacaggtctacggagctgcccacaagctgtgtagtggactctggatgcggctagctgtgtcagcaccatgctgaggtgggcttcttggtgctgaagctgcccgagtctcctatctaagggaccccaataaagtcattgttcccctag

//