2025-02-21 06:35:59, GGRNA.v2 : RefSeq release 228 (Jan, 2025)
LOCUS NM_019500 1475 bp mRNA linear ROD 08-OCT-2024 DEFINITION Mus musculus claudin 14 (Cldn14), transcript variant 1, mRNA. ACCESSION NM_019500 VERSION NM_019500.4 KEYWORDS RefSeq; RefSeq Select. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE 1 (bases 1 to 1475) AUTHORS Mohanty,S., White,J.K., Scheffschick,A., Fischer,B., Pathak,A., Tovi,J., Ostenson,C.G., Aspenstrom,P., Brauner,H. and Brauner,A. TITLE Diabetes compromises tight junction protein claudin 14 in the urinary bladder JOURNAL Cell Tissue Res 398 (1), 27-33 (2024) PUBMED 39162877 REMARK GeneRIF: Diabetes compromises tight junction protein claudin 14 in the urinary bladder. REFERENCE 2 (bases 1 to 1475) AUTHORS Higashi,A.Y., Higashi,T., Furuse,K., Ozeki,K., Furuse,M. and Chiba,H. TITLE Claudin-9 constitutes tight junctions of folliculo-stellate cells in the anterior pituitary gland JOURNAL Sci Rep 11 (1), 21642 (2021) PUBMED 34737342 REMARK Publication Status: Online-Only REFERENCE 3 (bases 1 to 1475) AUTHORS Krohs,C., Korber,C., Ebbers,L., Altaf,F., Hollje,G., Hoppe,S., Dorflinger,Y., Prosser,H.M. and Nothwang,H.G. TITLE Loss of miR-183/96 Alters Synaptic Strength via Presynaptic and Postsynaptic Mechanisms at a Central Synapse JOURNAL J Neurosci 41 (32), 6796-6811 (2021) PUBMED 34193555 REFERENCE 4 (bases 1 to 1475) AUTHORS Frische,S., Alexander,R.T., Ferreira,P., Tan,R.S.G., Wang,W., Svenningsen,P., Skjodt,K. and Dimke,H. TITLE Localization and regulation of claudin-14 in experimental models of hypercalcemia JOURNAL Am J Physiol Renal Physiol 320 (1), F74-F86 (2021) PUBMED 33283646 REMARK GeneRIF: Localization and regulation of claudin-14 in experimental models of hypercalcemia. REFERENCE 5 (bases 1 to 1475) AUTHORS Claussen,M., Schulze,J. and Nothwang,H.G. TITLE Loss of inner hair cell ribbon synapses and auditory nerve fiber regression in Cldn14 knockout mice JOURNAL Hear Res 391, 107950 (2020) PUBMED 32251970 REMARK GeneRIF: Loss of inner hair cell ribbon synapses and auditory nerve fiber regression in Cldn14 knockout mice. REFERENCE 6 (bases 1 to 1475) AUTHORS Elkouby-Naor,L., Abassi,Z., Lagziel,A., Gow,A. and Ben-Yosef,T. TITLE Double gene deletion reveals lack of cooperation between claudin 11 and claudin 14 tight junction proteins JOURNAL Cell Tissue Res 333 (3), 427-438 (2008) PUBMED 18663477 REMARK GeneRIF: We generated claudin 11/claudin 14 double-deficient mice, which exhibit deafness, neurological deficits, and male sterility. Kidney function and ion balance are not significantly affected. REFERENCE 7 (bases 1 to 1475) AUTHORS Krause,G., Winkler,L., Mueller,S.L., Haseloff,R.F., Piontek,J. and Blasig,I.E. TITLE Structure and function of claudins JOURNAL Biochim Biophys Acta 1778 (3), 631-645 (2008) PUBMED 18036336 REMARK Review article REFERENCE 8 (bases 1 to 1475) AUTHORS Nunes,F.D., Lopez,L.N., Lin,H.W., Davies,C., Azevedo,R.B., Gow,A. and Kachar,B. TITLE Distinct subdomain organization and molecular composition of a tight junction with adherens junction features JOURNAL J Cell Sci 119 (Pt 23), 4819-4827 (2006) PUBMED 17130295 REFERENCE 9 (bases 1 to 1475) AUTHORS Ben-Yosef,T., Belyantseva,I.A., Saunders,T.L., Hughes,E.D., Kawamoto,K., Van Itallie,C.M., Beyer,L.A., Halsey,K., Gardner,D.J., Wilcox,E.R., Rasmussen,J., Anderson,J.M., Dolan,D.F., Forge,A., Raphael,Y., Camper,S.A. and Friedman,T.B. TITLE Claudin 14 knockout mice, a model for autosomal recessive deafness DFNB29, are deaf due to cochlear hair cell degeneration JOURNAL Hum Mol Genet 12 (16), 2049-2061 (2003) PUBMED 12913076 REMARK GeneRIF: To explore the role of claudin 14 in the inner ear and in other tissues we created a mouse model by a targeted deletion of Cldn14. REFERENCE 10 (bases 1 to 1475) AUTHORS Wilcox,E.R., Burton,Q.L., Naz,S., Riazuddin,S., Smith,T.N., Ploplis,B., Belyantseva,I., Ben-Yosef,T., Liburd,N.A., Morell,R.J., Kachar,B., Wu,D.K., Griffith,A.J., Riazuddin,S. and Friedman,T.B. TITLE Mutations in the gene encoding tight junction claudin-14 cause autosomal recessive deafness DFNB29 JOURNAL Cell 104 (1), 165-172 (2001) PUBMED 11163249 COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AC165961.2, AC168220.1, BE863348.1 and AI851731.1. On Oct 8, 2009 this sequence version replaced NM_019500.3. Summary: This gene encodes a member of the claudin family of tight junction proteins. The encoded protein is an integral membrane protein that may function in maintaining apical membrane polarization in tight junctions located between outer hair cells and supporting cells. Loss of function of this gene is associated with hearing problems. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2009]. Transcript Variant: This variant (1) represents the longest transcript. Variants 1, 2 and 3 encode the same protein. Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: AF314089.2, BC138497.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMN01164131, SAMN01164132 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on conservation, expression, longest protein ##RefSeq-Attributes-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-313 AC165961.2 92817-93129 314-451 AC168220.1 55748-55885 452-760 BE863348.1 124-432 761-1024 AC168220.1 78425-78688 1025-1475 AI851731.1 1-451 c FEATURES Location/Qualifiers source 1..1475 /organism="Mus musculus" /mol_type="mRNA" /strain="C57BL/6" /db_xref="taxon:10090" /chromosome="16" /map="16 54.99 cM" gene 1..1475 /gene="Cldn14" /note="claudin 14" /db_xref="GeneID:56173" /db_xref="MGI:MGI:1860425" exon 1..313 /gene="Cldn14" /inference="alignment:Splign:2.1.0" exon 314..451 /gene="Cldn14" /inference="alignment:Splign:2.1.0" exon 452..1458 /gene="Cldn14" /inference="alignment:Splign:2.1.0" misc_feature 515..517 /gene="Cldn14" /note="upstream in-frame stop codon" CDS 533..1252 /gene="Cldn14" /codon_start=1 /product="claudin-14" /protein_id="NP_062373.3" /db_xref="CCDS:CCDS28345.1" /db_xref="GeneID:56173" /db_xref="MGI:MGI:1860425" /translation="
MASTAVQLLGFLLSFLGMVGTLITTILPHWRRTAHVGTNILTAVSYLKGLWMECVWHSTGIYQCQIYRSLLALPRDLQAARALMVISCLLSGMACACAVVGMKCTRCAKGTPAKTTFAVLGGALFLLAGLLCMVAVSWTTNDVVQNFYNPLLPSGMKFEIGQALYLGFISSSLSLIGGTLLCLSCQDEAPYRPYPPQSRAGATTTATAPAYRPPAAYKDNRAPSVTSAAHSGYRLNDYV"
misc_feature 554..616 /gene="Cldn14" /note="propagated from UniProtKB/Swiss-Prot (Q9Z0S3.2); transmembrane region" misc_feature 599..1075 /gene="Cldn14" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:473919" misc_feature 776..838 /gene="Cldn14" /note="propagated from UniProtKB/Swiss-Prot (Q9Z0S3.2); transmembrane region" misc_feature 878..940 /gene="Cldn14" /note="propagated from UniProtKB/Swiss-Prot (Q9Z0S3.2); transmembrane region" misc_feature 1019..1081 /gene="Cldn14" /note="propagated from UniProtKB/Swiss-Prot (Q9Z0S3.2); transmembrane region" regulatory 1435..1440 /regulatory_class="polyA_signal_sequence" /gene="Cldn14" /note="hexamer: AATAAA" polyA_site 1458 /gene="Cldn14" /note="major polyA site" ORIGIN
gtcggaatggcatgttctgaaagggcagcgttgatagctgaaactaggtgcgcctcaggccggggctgtgggaagcccgagcatcttgggcaccagcaaagtttctagcagccttgggaaggagaggaaagtcaggtggatctgattggtgggaaaggtgacctggggaaacttgccctgtggttcatacaacctgccaggcagaagcaggagccaggggcacctgagcaagaaaccccataagatgttcaagtggagttccagacaggcacctggatatagttctggacccggagggggacgcgtcaacactgggctgcatggcccagcgatctggacaaaggccaagaagccaaagactgttgaagccgcagtctccactcttctactgacgccagcgaccacccagcccagccaggccatatggcctcctgcttgcctgatgtatgaggcttcctgcgggcacctaaggaccagatccatccctggggacctgggcactgctcagcgcggctagcaggggcccttagccatggccagcacagcggtccagctcctaggcttcctgcttagcttcctgggcatggtaggaacgctcatcaccaccatcctgccacactggcggaggacggcccatgtgggcaccaacatcctgactgccgtatcctacctgaagggactgtggatggaatgtgtgtggcacagcacaggcatctaccagtgtcagatctaccgctcactgctggcgctgccccgggacttgcaggccgcccgggcgctcatggtcatctcctgcctgttgtcgggcatggcctgcgcctgcgcagtagtgggcatgaagtgcacacgctgcgccaaaggcacacccgccaagaccacctttgcagtgctggggggcgcgctcttcctgctggccggcctgctgtgcatggtggccgtgtcctggaccacgaatgacgtggtgcagaatttttataacccgctgctgcccagtggcatgaagtttgaaatcggccaggccctgtacctgggcttcatctcctcatccctgtctctcatcgggggcaccctgctctgcttatcctgccaggacgaggccccctacagaccctacccgccccagtccagggccggagctaccaccacggctaccgcccctgcctaccgcccaccagcggcctacaaggacaaccgtgccccctcggtgacctcagccgcgcacagtgggtacaggctgaatgactacgtgtgagttccttccccgggcttctgccagggatgctgggccccaaaggaccaatgatggatgtgggaaggatgcagagagcaagcccggaacacagggaaggaggtgctcttcaaagcaaagacttctaaaaagtgctggttttttatttattatatgtatttatgcgggtggcttaataagagctcaataaagagtgtcttggaagcgtgaaaaaaaaaaaaaaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]