LOCUS       NM_018777               1497 bp    mRNA    linear   ROD 16-OCT-2024
DEFINITION  Mus musculus claudin 6 (Cldn6), transcript variant 1, mRNA.
ACCESSION   NM_018777
VERSION     NM_018777.5
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 1497)
  AUTHORS   Jin,Q., Qi,D., Zhang,M., Qu,H., Dong,Y., Sun,M. and Quan,C.
  TITLE     CLDN6 inhibits breast cancer growth and metastasis through
            SREBP1-mediated RAS palmitoylation
  JOURNAL   Cell Mol Biol Lett 29 (1), 112 (2024)
   PUBMED   39169280
  REMARK    GeneRIF: CLDN6 inhibits breast cancer growth and metastasis through
            SREBP1-mediated RAS palmitoylation.
            Publication Status: Online-Only
REFERENCE   2  (bases 1 to 1497)
  AUTHORS   Zhu,Y., Huang,Y., Tang,T. and Xie,Y.
  TITLE     HDAC1 and HDAC2 orchestrate Wnt signaling to regulate neural
            progenitor transition during brain development
  JOURNAL   iScience 27 (9), 110600 (2024)
   PUBMED   39224519
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 1497)
  AUTHORS   Kumar,N., Prakash,P.G., Wentland,C., Kurian,S.M., Jethva,G.,
            Brinkmann,V., Mollenkopf,H.J., Krammer,T., Toussaint,C.,
            Saliba,A.E., Biebl,M., Jurgensen,C., Wiedenmann,B., Meyer,T.F.,
            Gurumurthy,R.K. and Chumduri,C.
  TITLE     Decoding spatiotemporal transcriptional dynamics and epithelial
            fibroblast crosstalk during gastroesophageal junction development
            through single cell analysis
  JOURNAL   Nat Commun 15 (1), 3064 (2024)
   PUBMED   38594232
  REMARK    Publication Status: Online-Only
REFERENCE   4  (bases 1 to 1497)
  AUTHORS   Dong,Y., Jin,Q., Sun,M., Qi,D., Qu,H., Wang,X. and Quan,C.
  TITLE     CLDN6 inhibits breast cancer metastasis through WIP-dependent actin
            cytoskeleton-mediated autophagy
  JOURNAL   J Exp Clin Cancer Res 42 (1), 68 (2023)
   PUBMED   36935496
  REMARK    GeneRIF: CLDN6 inhibits breast cancer metastasis through
            WIP-dependent actin cytoskeleton-mediated autophagy.
            Publication Status: Online-Only
REFERENCE   5  (bases 1 to 1497)
  AUTHORS   Gu,R., Zhang,S., Saha,S.K., Ji,Y., Reynolds,K., McMahon,M., Sun,B.,
            Islam,M., Trainor,P.A., Chen,Y., Xu,Y., Chai,Y., Burkart-Waco,D.
            and Zhou,C.J.
  TITLE     Single-cell transcriptomic signatures and gene regulatory networks
            modulated by Wls in mammalian midline facial formation and clefts
  JOURNAL   Development 149 (14) (2022)
   PUBMED   35781558
REFERENCE   6  (bases 1 to 1497)
  AUTHORS   Niimi,T., Nagashima,K., Ward,J.M., Minoo,P., Zimonjic,D.B.,
            Popescu,N.C. and Kimura,S.
  TITLE     claudin-18, a novel downstream target gene for the T/EBP/NKX2.1
            homeodomain transcription factor, encodes lung- and
            stomach-specific isoforms through alternative splicing
  JOURNAL   Mol Cell Biol 21 (21), 7380-7390 (2001)
   PUBMED   11585919
REFERENCE   7  (bases 1 to 1497)
  AUTHORS   Neidhardt,L., Gasca,S., Wertz,K., Obermayr,F., Worpenberg,S.,
            Lehrach,H. and Herrmann,B.G.
  TITLE     Large-scale screen for genes controlling mammalian embryogenesis,
            using high-throughput gene expression analysis in mouse embryos
  JOURNAL   Mech Dev 98 (1-2), 77-94 (2000)
   PUBMED   11044609
REFERENCE   8  (bases 1 to 1497)
  AUTHORS   Itoh,M., Furuse,M., Morita,K., Kubota,K., Saitou,M. and Tsukita,S.
  TITLE     Direct binding of three tight junction-associated MAGUKs, ZO-1,
            ZO-2, and ZO-3, with the COOH termini of claudins
  JOURNAL   J Cell Biol 147 (6), 1351-1363 (1999)
   PUBMED   10601346
REFERENCE   9  (bases 1 to 1497)
  AUTHORS   Morita,K., Sasaki,H., Furuse,M. and Tsukita,S.
  TITLE     Endothelial claudin: claudin-5/TMVCF constitutes tight junction
            strands in endothelial cells
  JOURNAL   J Cell Biol 147 (1), 185-194 (1999)
   PUBMED   10508865
REFERENCE   10 (bases 1 to 1497)
  AUTHORS   Morita,K., Furuse,M., Fujimoto,K. and Tsukita,S.
  TITLE     Claudin multigene family encoding four-transmembrane domain protein
            components of tight junction strands
  JOURNAL   Proc Natl Acad Sci U S A 96 (2), 511-516 (1999)
   PUBMED   9892664
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            AC154766.2.
            
            On Nov 14, 2022 this sequence version replaced NM_018777.4.
            
            Summary: This gene encodes a member of the claudin family. Claudins
            are integral membrane proteins and components of tight junction
            strands. Tight junction strands serve as a physical barrier to
            prevent solutes and water from passing freely through the
            paracellular space between epithelial or endothelial cell sheets,
            and also play critical roles in maintaining cell polarity and
            signal transductions. The protein encoded by this gene is essential
            for blastocyst formation in preimplantation mouse embryos, and is
            invloved in and is crucial for the formation and maintenance of the
            epidermal permeability barrier. This gene is adjacent to another
            family member Cldn9 on chromosome 17. [provided by RefSeq, Aug
            2010].
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC005718.1, AK010682.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN00849374, SAMN00849375
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on conservation, expression,
                                      longest protein
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-37                AC154766.2         13713-13749         c
            38-101              AC154766.2         13299-13362         c
            102-1497            AC154766.2         10677-12072         c
FEATURES             Location/Qualifiers
     source          1..1497
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="C57BL/6"
                     /db_xref="taxon:10090"
                     /chromosome="17"
                     /map="17 11.99 cM"
     gene            1..1497
                     /gene="Cldn6"
                     /note="claudin 6"
                     /db_xref="GeneID:54419"
                     /db_xref="MGI:MGI:1859284"
     exon            1..37
                     /gene="Cldn6"
                     /inference="alignment:Splign:2.1.0"
     exon            38..101
                     /gene="Cldn6"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    88..90
                     /gene="Cldn6"
                     /note="upstream in-frame stop codon"
     exon            102..1497
                     /gene="Cldn6"
                     /inference="alignment:Splign:2.1.0"
     CDS             118..777
                     /gene="Cldn6"
                     /note="tight junction molecule claudin 6; skullin"
                     /codon_start=1
                     /product="claudin-6"
                     /protein_id="NP_061247.1"
                     /db_xref="CCDS:CCDS28457.1"
                     /db_xref="GeneID:54419"
                     /db_xref="MGI:MGI:1859284"
                     /translation="

MASTGLQILGIVLTLLGWVNALVSCALPMWKVTAFIGNSIVVAQMVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVVTLLIVLLGLLVYLAGAKCTTCVEDRNSKSRLVLISGIIFVISGVLTLIPVCWTAHSIIQDFYNPLVADAQKRELGASLYLGWAASGLLLLGGGLLCCACSSGGTQGPRHYMACYSTSVPHSRGPSEYPTKNYV"

     misc_feature    127..627
                     /gene="Cldn6"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; cl21598"
                     /db_xref="CDD:473919"
     misc_feature    139..201
                     /gene="Cldn6"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9Z262.1);
                     transmembrane region"
     misc_feature    361..423
                     /gene="Cldn6"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9Z262.1);
                     transmembrane region"
     misc_feature    466..528
                     /gene="Cldn6"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9Z262.1);
                     transmembrane region"
     misc_feature    607..669
                     /gene="Cldn6"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9Z262.1);
                     transmembrane region"
     misc_feature    718..720
                     /gene="Cldn6"
                     /note="Phosphoserine.
                     /evidence=ECO:0000250|UniProtKB:P56747; propagated from
                     UniProtKB/Swiss-Prot (Q9Z262.1); phosphorylation site"
     misc_feature    724..726
                     /gene="Cldn6"
                     /note="Phosphoserine.
                     /evidence=ECO:0000250|UniProtKB:P56747; propagated from
                     UniProtKB/Swiss-Prot (Q9Z262.1); phosphorylation site"
     misc_feature    736..738
                     /gene="Cldn6"
                     /note="Phosphoserine.
                     /evidence=ECO:0000250|UniProtKB:P56747; propagated from
                     UniProtKB/Swiss-Prot (Q9Z262.1); phosphorylation site"
     misc_feature    748..750
                     /gene="Cldn6"
                     /note="Phosphoserine.
                     /evidence=ECO:0000250|UniProtKB:P56747; propagated from
                     UniProtKB/Swiss-Prot (Q9Z262.1); phosphorylation site"
     misc_feature    769..774
                     /gene="Cldn6"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9Z262.1);
                     Region: Interactions with TJP1, TJP2 and TJP3.
                     /evidence=ECO:0000250"
     regulatory      1473..1478
                     /regulatory_class="polyA_signal_sequence"
                     /gene="Cldn6"
                     /note="hexamer: AATAAA"
     polyA_site      1497
                     /gene="Cldn6"
                     /note="major polyA site"
ORIGIN      

actttcgacctggaaatcttagcagtctcttttgcaggctcggatatcaggggtggccgaaccggactggacgtccgcagacaaagctgaccgagcactcgccccctcaacctcatcatggcctctactggtctgcaaatcttggggatcgtcctgaccctgcttggctgggtcaacgccctggtgtcctgtgccctgcccatgtggaaggtgaccgccttcatcggcaacagcatcgtcgtggcccagatggtgtgggaggggctgtggatgtcctgtgtggttcagagcactggccagatgcagtgcaaggtgtatgactcactgttggcgctgccccaggacctgcaggctgccagagccctctgtgttgtcaccctcctcattgtcctgcttggcctgctcgtgtacctggctggagccaagtgcactacctgtgtggaagataggaactccaagtctcgtctggtgctcatctctggcatcatctttgtcatttctggggtcctgacgctcattcctgtctgctggactgcccactctatcatccaggacttctacaaccccttggtggctgatgctcaaaagcgggagctgggggcctccctctacctgggctgggcagcctcaggccttttgctgctgggtggagggctactatgctgcgcctgctcttctggagggacccagggacccagacattacatggcctgctattctacatctgtcccacattctcggggaccctccgaatatcccaccaagaattatgtgtgatgctcactggggagtgaggctctgctagccagggaacctgagctgagccatcaagaaaggttacggagtagtttgggggttgtcttatttcttgtttttcttttgtactactgggtattgaacctggggccccacgcatttggtaggcaagcactcaccagtgagtcatgtggtgccctgtctgtccctagggtttgttccacctgtttttgagacaagctcttctcatggagctctgatcgacctccagctccagttttcctgcctcaacctgagtccaagctccacctctctctctgctgctggcatttctcacttttagctactgaggctgggaggatgggacacttgagtttctgcgtcattattcattctggggatcttctgtgcagtgttctaaggctgcctggcctttgtttttctcaaaatatcctgtcccagtcccaagagttcctgctgtggccggaggtaactcacaggacagacgcaccccttcctggtcagacttctctccagccctggaagggcaggtgataagttaccaaggaattttctaccctgagacttccaacctttggcccctgaatcccatcgccaaggttactgtgtactctccctacaaaaggtcccagctgtgctgtagaccctcctcccccacaccttgcacacttccctgctcacacaatgctttactaaataaaacatgatttttttttctta

//