LOCUS       NM_016675               3069 bp    mRNA    linear   ROD 08-AUG-2024
DEFINITION  Mus musculus claudin 2 (Cldn2), transcript variant 1, mRNA.
ACCESSION   NM_016675
VERSION     NM_016675.5
KEYWORDS    RefSeq.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 3069)
  AUTHORS   Oami,T., Abtahi,S., Shimazui,T., Chen,C.W., Sweat,Y.Y., Liang,Z.,
            Burd,E.M., Farris,A.B., Roland,J.T., Tsukita,S., Ford,M.L.,
            Turner,J.R. and Coopersmith,C.M.
  TITLE     Claudin-2 upregulation enhances intestinal permeability, immune
            activation, dysbiosis, and mortality in sepsis
  JOURNAL   Proc Natl Acad Sci U S A 121 (10), e2217877121 (2024)
   PUBMED   38412124
  REMARK    GeneRIF: Claudin-2 upregulation enhances intestinal permeability,
            immune activation, dysbiosis, and mortality in sepsis.
REFERENCE   2  (bases 1 to 3069)
  AUTHORS   Ahmad,R., Kumar,B., Thapa,I., Tamang,R.L., Yadav,S.K.,
            Washington,M.K., Talmon,G.A., Yu,A.S., Bastola,D.K., Dhawan,P. and
            Singh,A.B.
  TITLE     Claudin-2 protects against colitis-associated cancer by promoting
            colitis-associated mucosal healing
  JOURNAL   J Clin Invest 133 (23), e170771 (2023)
   PUBMED   37815870
  REMARK    GeneRIF: Claudin-2 protects against colitis-associated cancer by
            promoting colitis-associated mucosal healing.
            Publication Status: Online-Only
REFERENCE   3  (bases 1 to 3069)
  AUTHORS   Ahmad,R., Kumar,B., Tamang,R.L., Talmon,G.A., Dhawan,P. and
            Singh,A.B.
  TITLE     P62/SQSTM1 binds with claudin-2 to target for selective autophagy
            in stressed intestinal epithelium
  JOURNAL   Commun Biol 6 (1), 740 (2023)
   PUBMED   37460613
  REMARK    GeneRIF: P62/SQSTM1 binds with claudin-2 to target for selective
            autophagy in stressed intestinal epithelium.
            Publication Status: Online-Only
REFERENCE   4  (bases 1 to 3069)
  AUTHORS   Beggs,M.R., Young,K., Plain,A., O'Neill,D.D., Raza,A.,
            Flockerzi,V., Dimke,H. and Alexander,R.T.
  TITLE     Maternal Epidermal Growth Factor Promotes Neonatal Claudin-2
            Dependent Increases in Small Intestinal Calcium Permeability
  JOURNAL   Function (Oxf) 4 (5), zqad033 (2023)
   PUBMED   37575484
  REMARK    Publication Status: Online-Only
REFERENCE   5  (bases 1 to 3069)
  AUTHORS   Cabuzu,D., Ramakrishnan,S.K., Moor,M.B., Harmacek,D., Auberson,M.,
            Durussel,F. and Bonny,O.
  TITLE     Loss of Ecrg4 improves calcium oxalate nephropathy
  JOURNAL   PLoS One 17 (10), e0275972 (2022)
   PUBMED   36227903
  REMARK    Publication Status: Online-Only
REFERENCE   6  (bases 1 to 3069)
  AUTHORS   Kubota,K., Furuse,M., Sasaki,H., Sonoda,N., Fujita,K., Nagafuchi,A.
            and Tsukita,S.
  TITLE     Ca(2+)-independent cell-adhesion activity of claudins, a family of
            integral membrane proteins localized at tight junctions
  JOURNAL   Curr Biol 9 (18), 1035-1038 (1999)
   PUBMED   10508613
REFERENCE   7  (bases 1 to 3069)
  AUTHORS   Morita,K., Furuse,M., Fujimoto,K. and Tsukita,S.
  TITLE     Claudin multigene family encoding four-transmembrane domain protein
            components of tight junction strands
  JOURNAL   Proc Natl Acad Sci U S A 96 (2), 511-516 (1999)
   PUBMED   9892664
REFERENCE   8  (bases 1 to 3069)
  AUTHORS   Citi,S. and Cordenonsi,M.
  TITLE     Tight junction proteins
  JOURNAL   Biochim Biophys Acta 1448 (1), 1-11 (1998)
   PUBMED   9824655
  REMARK    Review article
REFERENCE   9  (bases 1 to 3069)
  AUTHORS   Furuse,M., Sasaki,H., Fujimoto,K. and Tsukita,S.
  TITLE     A single gene product, claudin-1 or -2, reconstitutes tight
            junction strands and recruits occludin in fibroblasts
  JOURNAL   J Cell Biol 143 (2), 391-401 (1998)
   PUBMED   9786950
REFERENCE   10 (bases 1 to 3069)
  AUTHORS   Furuse,M., Fujita,K., Hiiragi,T., Fujimoto,K. and Tsukita,S.
  TITLE     Claudin-1 and -2: novel integral membrane proteins localizing at
            tight junctions with no sequence similarity to occludin
  JOURNAL   J Cell Biol 141 (7), 1539-1550 (1998)
   PUBMED   9647647
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from AL672243.12.
            
            On Aug 8, 2022 this sequence version replaced NM_016675.4.
            
            Summary: This gene encodes a member of the claudin family. Claudins
            are integral membrane proteins and components of tight junction
            strands. Tight junction strands serve as a physical barrier to
            prevent solutes and water from passing freely through the
            paracellular space between epithelial or endothelial cell sheets,
            and also play critical roles in maintaining cell polarity and
            signal transductions. The knockout mice lacking this gene display
            normal appearance, activity, growth and behavior, but are defective
            in the leaky and cation-selective paracellular permeability
            properties of renal proximal tubules. The proteins encoded by this
            gene and another family member Cldn12 are also critical for vitamin
            D-dependent Ca2+ absorption between enterocytes. [provided by
            RefSeq, Aug 2010].
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC085494.1, SRR1660821.136597.1
                                           [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN00849374, SAMN00849381
                                           [ECO:0000348]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-208               AL672243.12        58430-58637
            209-3069            AL672243.12        66153-69013
FEATURES             Location/Qualifiers
     source          1..3069
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="C57BL/6"
                     /db_xref="taxon:10090"
                     /chromosome="X"
                     /map="X 61.35 cM"
     gene            1..3069
                     /gene="Cldn2"
                     /note="claudin 2"
                     /db_xref="GeneID:12738"
                     /db_xref="MGI:MGI:1276110"
     exon            1..208
                     /gene="Cldn2"
                     /inference="alignment:Splign:2.1.0"
     exon            209..3069
                     /gene="Cldn2"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    307..309
                     /gene="Cldn2"
                     /note="upstream in-frame stop codon"
     CDS             391..1083
                     /gene="Cldn2"
                     /codon_start=1
                     /product="claudin-2"
                     /protein_id="NP_057884.1"
                     /db_xref="CCDS:CCDS30437.1"
                     /db_xref="GeneID:12738"
                     /db_xref="MGI:MGI:1276110"
                     /translation="

MASLGVQLVGYILGLLGLLGTSIAMLLPNWRTSSYVGASIVTAVGFSKGLWMECATHSTGITQCDIYSTLLGLPADIQAAQAMMVTSSAMSSLACIISVVGMRCTVFCQDSRAKDRVAVVGGVFFILGGILGFIPVAWNLHGILRDFYSPLVPDSMKFEIGEALYLGIISALFSLVAGVILCFSCSPQGNRTNYYDGYQAQPLATRSSPRSAQQPKAKSEFNSYSLTGYV"

     misc_feature    403..933
                     /gene="Cldn2"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; cl21598"
                     /db_xref="CDD:473919"
     misc_feature    412..474
                     /gene="Cldn2"
                     /note="propagated from UniProtKB/Swiss-Prot (O88552.1);
                     transmembrane region"
     misc_feature    583..585
                     /gene="Cldn2"
                     /note="Paracellular cation selectivity.
                     /evidence=ECO:0000269|PubMed:19114638; propagated from
                     UniProtKB/Swiss-Prot (O88552.1); other site"
     misc_feature    634..696
                     /gene="Cldn2"
                     /note="propagated from UniProtKB/Swiss-Prot (O88552.1);
                     transmembrane region"
     misc_feature    739..801
                     /gene="Cldn2"
                     /note="propagated from UniProtKB/Swiss-Prot (O88552.1);
                     transmembrane region"
     misc_feature    877..939
                     /gene="Cldn2"
                     /note="propagated from UniProtKB/Swiss-Prot (O88552.1);
                     transmembrane region"
     misc_feature    1003..1080
                     /gene="Cldn2"
                     /note="propagated from UniProtKB/Swiss-Prot (O88552.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    1045..1047
                     /gene="Cldn2"
                     /note="Phosphoserine.
                     /evidence=ECO:0007744|PubMed:21183079; propagated from
                     UniProtKB/Swiss-Prot (O88552.1); phosphorylation site"
     misc_feature    1057..1059
                     /gene="Cldn2"
                     /note="Phosphoserine.
                     /evidence=ECO:0007744|PubMed:21183079; propagated from
                     UniProtKB/Swiss-Prot (O88552.1); phosphorylation site"
     misc_feature    1075..1080
                     /gene="Cldn2"
                     /note="propagated from UniProtKB/Swiss-Prot (O88552.1);
                     Region: Interactions with TJP1, TJP2 and TJP3.
                     /evidence=ECO:0000250"
     regulatory      3046..3051
                     /regulatory_class="polyA_signal_sequence"
                     /gene="Cldn2"
                     /note="hexamer: AATAAA"
     polyA_site      3069
                     /gene="Cldn2"
                     /note="major polyA site"
ORIGIN      

gtaccgcaatcttttccagcctccaagggtttcattcccatctgtaagaaggctcagagttacaggtggagtttacaaagctgtggctaataattagaaatcccttatcaccacagcttgtgaccccttggaccccgttcgcctttctctggacctagtccttgtccccagaagcgtctcttccagagctcttcgaaaggacggctccgttttctagatgccttcttgagcctgcttgtggccacccacagatacttgtaaggaggaaagaagtcagcttgccagagacactgtgaaataagggattagaggctcggatccaagaagcaagagcagcagccaaacgacaagcaaacaggctccgaagatacttctactgagaggtctgccatggcctcccttggcgtccaactggtgggctacatcctaggccttttggggctgttaggcacatccattgccatgctgcttcccaactggcgaacgagttcctatgttggtgccagcattgtgacggcggttggcttttccaagggcctctggatggagtgtgcgacacacagcacaggcatcacccagtgcgatatctacagtacccttttaggacttcctgctgacatccaggctgcccaggccatgatggtgacgtccagtgcaatgtcctcgctggcttgtattatctctgtggtgggcatgagatgcaccgtgttctgccaggattctcgagctaaggacagagtggctgtagtgggtggagtctttttcatccttggtggcatcctgggctttatcccagttgcttggaatcttcatggcatccttcgggacttctactcgccgctggttcctgacagcatgaaatttgagattggagaggctctgtacttgggcatcatctcagccctgttttctttggtagccggagtcatcctttgcttttcctgctcgccccagggcaatcgtaccaactactatgatggctaccaggcccagcctcttgccactaggagctctccaagatctgctcaacagcccaaagccaagagtgagttcaactcatacagcctgactgggtatgtgtgaagaaccaggggccagagctgggggtagggtggggtagtggctgggactatatatataaaaaaaagcagtggacaatgcccccagggtcacaagcaaaggacattgccactgaatcatgtgtaaggtgctgctgagggtagaatgactttggccattggatggagtgaaggcagagatgagaagaggggtgtcagcatgtagatggcattgccaaggacgcttgccaagctagcttttctatttccctcacctgacctcactaaagtacctcctgtgctttgaatgctcaacccaaaagcccaaatcccatctctgccactttaggctatgcccagaggctctcttctgccctttggtttacttggagatctgtccccaaaccaatcatatcctgttgactaatcacctgtgatcaaaagaccctctccctctggctgaggttggctcttaactcaattactaagggacagagagaagaaagagtggtggcttctgtgaggacatttctagctcccttctcaaatctccagccaaagaaatggattagtcagtaatgggccctgaagcttctcttccagttttgctatgaatgcagtatgtccagactgcattgtgaatgaactgaaggaaagctatctcatggcatccagcagaatacagctgggtgcaggatgggaggcaacctgggatctaaagaaacaaaacaaacagcaaaacccgacagaatcccttctcaggccatctcctataattcccgtacatttgtgggtcagggatggaagcactgctaaggaaagcacaagaagccaagggaaagcacatggctgctgccctctgactccacagaggaattgcccagaagccaaggtgaacacggaccactgaaagctctgcctcccactggggtgtctgacccagcttcctgctaaaccacaagacttggagccctagacaagggtttccttaaggacaataaaccagtttttctagaactgccctttgacatgcgagttgcagaaggcttaaaaaaaatactaccctttagccctgaccgagaaagaataagggcttgggtatcaaagaaccggacagagatgtgtggtagctgttatgtgtgctcctactgtttcagagaggcagccctaccagatactttagacttgatggaagaccaacccatcagggtctatgtctcagcactacagagcctctgaaagaccacagcaccagagaggtcctttgtcacttttcacacttgagtcatcgcccatcagaagatactctcacaggtatgcaaagtctccagtgtggaacatctgtgaccaaggtgttgtgttcatgacctgagcaattggtgaacttctgcctgggattgtgcttgaggtgggagaacggagactggttccctgtccaacagttttatttccacggtcttaaaatgctccatttcttctgtggtagatgggggtcataaaccagagacatttccccaccaccaccagcttaatatcaccagcttcagaagatccccagcgcacctcatcaaaacttcagcaccggcaagagaggcccatatgtgaggtttcccttaacatgcctttcctatttccaccatattacttgtgttcaagctgatatgctgacctggaagccatttccttttaactaagtcatccccatgcttggagaacttgctcattgagccttctctgaccactccttcctgttctttcctttccctcctccaactcccaatatataaattgcctaatcctcatcattcataattttgattgatagtttatagttcttgtatgtgcatttgtgtgtgactctatccgtctgtctgtctgtgtgatctcaaaagttcactgtaagtacttggagggcaattgctatatcttagacctgtccatatgtatacccaagactgtaacagtgctgggcacacacaaggtgatcaataaacggatgttgattgagtaa

//