LOCUS       NM_013805               1420 bp    mRNA    linear   ROD 31-DEC-2024
DEFINITION  Mus musculus claudin 5 (Cldn5), mRNA.
ACCESSION   NM_013805
VERSION     NM_013805.4
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 1420)
  AUTHORS   Siegerist,F., Kliewe,F., Hammer,E., Schakau,P., Chi Soh,J.E.,
            Weber,C., Lindenmeyer,M., Reichelt-Wurm,S., Drenic,V.,
            Chatziantoniou,C., Chadjichristos,C.E., Zhang,Y., Simm,S.,
            Banas,M.C., Nauck,M., Volker,U. and Endlich,N.
  TITLE     The role of the tricellular junction protein ILDR2 in
            glomerulopathies: Expression patterns and functional insights
  JOURNAL   iScience 27 (12), 111329 (2024)
   PUBMED   39640577
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 1420)
  AUTHORS   Carus-Cadavieco,M., Gonzalez de la Fuente,S., Berenguer Lopez,I.,
            Serrano-Lope,M.A., Aguado,B., Guix,F., Palomer,E. and Dotti,C.G.
  TITLE     Loss of Cldn5 -and increase in Irf7-in the hippocampus and cerebral
            cortex of diabetic mice at the early symptomatic stage
  JOURNAL   Nutr Diabetes 14 (1), 64 (2024)
   PUBMED   39147772
  REMARK    GeneRIF: Loss of Cldn5 -and increase in Irf7-in the hippocampus and
            cerebral cortex of diabetic mice at the early symptomatic stage.
            Publication Status: Online-Only
REFERENCE   3  (bases 1 to 1420)
  AUTHORS   Zhang,Y., Chen,B., Wang,M., Liu,H., Chen,M., Zhu,J., Zhang,Y.,
            Wang,X., Wu,Y., Liu,D., Cui,G., Kitakaze,M., Kim,J.K., Wang,Y. and
            Luo,T.
  TITLE     A novel function of claudin-5 in maintaining the structural
            integrity of the heart and its implications in cardiac pathology
  JOURNAL   Biochim Biophys Acta Mol Basis Dis 1870 (6), 167274 (2024)
   PUBMED   38838411
  REMARK    GeneRIF: A novel function of claudin-5 in maintaining the
            structural integrity of the heart and its implications in cardiac
            pathology.
REFERENCE   4  (bases 1 to 1420)
  AUTHORS   Yuki,K., Vallon,M., Ding,J., Rada,C.C., Tang,A.T.,
            Vilches-Moure,J.G., McCormick,A.K., Henao Echeverri,M.F.,
            Alwahabi,S., Braunger,B.M., Ergun,S., Kahn,M.L. and Kuo,C.J.
  TITLE     GPR124 regulates murine brain embryonic angiogenesis and BBB
            formation by an intracellular domain-independent mechanism
  JOURNAL   Development 151 (11) (2024)
   PUBMED   38682276
REFERENCE   5  (bases 1 to 1420)
  AUTHORS   Vazquez-Liebanas,E., Mocci,G., Li,W., Lavina,B., Reddy,A.,
            O'Connor,C., Hudson,N., Elbeck,Z., Nikoloudis,I., Gaengel,K.,
            Vanlandewijck,M., Campbell,M., Betsholtz,C. and Mae,M.A.
  TITLE     Mosaic deletion of claudin-5 reveals rapid non-cell-autonomous
            consequences of blood-brain barrier leakage
  JOURNAL   Cell Rep 43 (3), 113911 (2024)
   PUBMED   38446668
  REMARK    GeneRIF: Mosaic deletion of claudin-5 reveals rapid
            non-cell-autonomous consequences of blood-brain barrier leakage.
REFERENCE   6  (bases 1 to 1420)
  AUTHORS   Citi,S. and Cordenonsi,M.
  TITLE     Tight junction proteins
  JOURNAL   Biochim Biophys Acta 1448 (1), 1-11 (1998)
   PUBMED   9824655
  REMARK    Review article
REFERENCE   7  (bases 1 to 1420)
  AUTHORS   Sutherland,H.F., Kim,U.J. and Scambler,P.J.
  TITLE     Cloning and comparative mapping of the DiGeorge syndrome critical
            region in the mouse
  JOURNAL   Genomics 52 (1), 37-43 (1998)
   PUBMED   9740669
REFERENCE   8  (bases 1 to 1420)
  AUTHORS   Chen,Z., Zandonatti,M., Jakubowski,D. and Fox,H.S.
  TITLE     Brain capillary endothelial cells express MBEC1, a protein that is
            related to the Clostridium perfringens enterotoxin receptors
  JOURNAL   Lab Invest 78 (3), 353-363 (1998)
   PUBMED   9520948
REFERENCE   9  (bases 1 to 1420)
  AUTHORS   Puech,A., Saint-Jore,B., Funke,B., Gilbert,D.J., Sirotkin,H.,
            Copeland,N.G., Jenkins,N.A., Kucherlapati,R., Morrow,B. and
            Skoultchi,A.I.
  TITLE     Comparative mapping of the human 22q11 chromosomal region and the
            orthologous region in mice reveals complex changes in gene
            organization
  JOURNAL   Proc Natl Acad Sci U S A 94 (26), 14608-14613 (1997)
   PUBMED   9405660
REFERENCE   10 (bases 1 to 1420)
  AUTHORS   Sirotkin,H., Morrow,B., Saint-Jore,B., Puech,A., Das Gupta,R.,
            Patanjali,S.R., Skoultchi,A., Weissman,S.M. and Kucherlapati,R.
  TITLE     Identification, characterization, and precise mapping of a human
            gene encoding a novel membrane-spanning protein from the 22q11
            region deleted in velo-cardio-facial syndrome
  JOURNAL   Genomics 42 (2), 245-251 (1997)
   PUBMED   9192844
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from BB872815.1, BC083341.1 and
            BE627334.1.
            
            On Aug 5, 2010 this sequence version replaced NM_013805.3.
            
            Summary: This gene encodes a member of the claudin family. Claudins
            are integral membrane proteins and components of tight junction
            strands. Tight junction strands serve as a physical barrier to
            prevent solutes and water from passing freely through the
            paracellular space between epithelial or endothelial cell sheets,
            and also play critical roles in maintaining cell polarity and
            signal transductions. The protein encoded by this gene is a
            critical component of endothelial tight junctions that control
            pericellular permeability. The knockout mice lacking this gene died
            within 10 h of birth and the blood-brain barrier in these mice
            against small molecules was selectively affected. This gene is
            expressed strongly in endothelium of normal lung and plays a
            regulation role during acrolein-induced acute lung injury.
            [provided by RefSeq, Aug 2010].
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript is intronless :: AK077282.1, AF035814.1 [ECO:0000345]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-10                BB872815.1         2-11
            11-1413             BC083341.1         1-1403
            1414-1420           BE627334.1         1-7                 c
FEATURES             Location/Qualifiers
     source          1..1420
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="C57BL/6"
                     /db_xref="taxon:10090"
                     /chromosome="16"
                     /map="16 11.63 cM"
     gene            1..1420
                     /gene="Cldn5"
                     /gene_synonym="MBEC1; Tmvcf"
                     /note="claudin 5"
                     /db_xref="GeneID:12741"
                     /db_xref="MGI:MGI:1276112"
     exon            1..1416
                     /gene="Cldn5"
                     /gene_synonym="MBEC1; Tmvcf"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    87..89
                     /gene="Cldn5"
                     /gene_synonym="MBEC1; Tmvcf"
                     /note="upstream in-frame stop codon"
     CDS             150..806
                     /gene="Cldn5"
                     /gene_synonym="MBEC1; Tmvcf"
                     /note="lung-specific membrane protein; brain endothelial
                     cell clone 1 protein; transmembrane protein deleted in
                     VCFS"
                     /codon_start=1
                     /product="claudin-5"
                     /protein_id="NP_038833.2"
                     /db_xref="CCDS:CCDS28026.1"
                     /db_xref="GeneID:12741"
                     /db_xref="MGI:MGI:1276112"
                     /translation="

MGSAALEILGLVLCLVGWVGLILACGLPMWQVTAFLDHNIVTAQTTWKGLWMSCVVQSTGHMQCKVYESVLALSAEVQAARALTVGAVLLALVALFVTLTGAQCTTCVAPGPVKARVALTGGALYAVCGLLALVPLCWFANIVVREFYDPTVPVSQKYELGAALYIGWAASALLMCGGGLVCCGAWVCTGRPEFSFPVKYSAPRRPTANGDYDKKNYV"

     misc_feature    162..689
                     /gene="Cldn5"
                     /gene_synonym="MBEC1; Tmvcf"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; cl21598"
                     /db_xref="CDD:473919"
     misc_feature    171..233
                     /gene="Cldn5"
                     /gene_synonym="MBEC1; Tmvcf"
                     /note="propagated from UniProtKB/Swiss-Prot (O54942.2);
                     transmembrane region"
     misc_feature    393..455
                     /gene="Cldn5"
                     /gene_synonym="MBEC1; Tmvcf"
                     /note="propagated from UniProtKB/Swiss-Prot (O54942.2);
                     transmembrane region"
     misc_feature    519..581
                     /gene="Cldn5"
                     /gene_synonym="MBEC1; Tmvcf"
                     /note="propagated from UniProtKB/Swiss-Prot (O54942.2);
                     transmembrane region"
     misc_feature    630..692
                     /gene="Cldn5"
                     /gene_synonym="MBEC1; Tmvcf"
                     /note="propagated from UniProtKB/Swiss-Prot (O54942.2);
                     transmembrane region"
     misc_feature    798..803
                     /gene="Cldn5"
                     /gene_synonym="MBEC1; Tmvcf"
                     /note="propagated from UniProtKB/Swiss-Prot (O54942.2);
                     Region: Interactions with TJP1, TJP2 and TJP3.
                     /evidence=ECO:0000250"
     regulatory      1393..1398
                     /regulatory_class="polyA_signal_sequence"
                     /gene="Cldn5"
                     /gene_synonym="MBEC1; Tmvcf"
                     /note="hexamer: AGTAAA"
     polyA_site      1416
                     /gene="Cldn5"
                     /gene_synonym="MBEC1; Tmvcf"
                     /note="major polyA site"
ORIGIN      

agttggtgtagttaaaacctcctcttctgctccaggactggaggctccagagcagaggcaccagaatcaattcccagctcccagcctaagcagcgcagagagcacccggaggccccaagggccgtcgggtgagcattcagtctttagccatggggtctgcagcgttggaaattctgggtctggtgctgtgtctggtaggatgggtgggcttgatcctggcgtgtgggctgcccatgtggcaggtgactgccttcctggaccacaacatcgtgacggcgcagacgacttggaaggggctgtggatgtcgtgcgtggtgcagagtaccgggcacatgcagtgcaaggtgtatgaatctgtgctggcgctgagtgcggaggtgcaggcagctcgggcactcaccgtgggcgctgtgctgctggcgctggtggcactctttgttaccttgaccggcgctcagtgcaccacctgcgtggccccgggcccagttaaggcacgggtagcactcacgggaggagcgctttacgcggtgtgcgggctgctggcactcgtgccgctctgctggttcgccaacatcgttgtccgcgagttctatgatccgacggtgccggtgtcacagaagtacgagctgggcgcggcgctgtacatcggctgggcggcctccgcactgctcatgtgcggtggcggcctcgtgtgttgcggcgcctgggtctgcaccgggcgccctgagttcagcttcccggtcaagtactctgcgccgcggcggcccacggccaatggcgattacgacaagaagaactatgtctaagggcgggaggcatggcggggctcttcccgcagctaagcccgcgatgggaaagaccgatgcgggaagccgtgtgtggatgacgaccaccgctgggttgcgcagcgcaagtcatgctgggttcgggccagacttgcccgctctcagagtccgttgaccatcactagccgggccctgctcagaacagactacaggcacttttaagaacttgaccgaccttttcttctatgcgcagttggccacgacgtgggtggaacgctcagatttcatcggtgaagtaggcaccaaactgccgcgaacagttcctactgagatcctgggggcactagatgctgccttaatgtccagtggcacctgctaacctgaaagggcagctggagaaaccccggggctgccagagggacgtgttaaaaagggcattttctttgttagtggagaagaacctactgaaccaaaggacttagcctggacctggtctcactccagcactcccccaaggtgggggccctgtaggtaccagagccttagaggggttgccttcctcctggaagcttggggcttggggggtgggccgggcaagaatttgctcagtaaatggtttgaacactttcaaaaaa

//