GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-04-20 02:41:12, GGRNA.v2 : RefSeq release 229 (Mar, 2025)

LOCUS       NM_010463                962 bp    mRNA    linear   ROD 02-MAY-2024
DEFINITION  Mus musculus homeobox C12 (Hoxc12), mRNA.
ACCESSION   NM_010463
VERSION     NM_010463.2
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 962)
  AUTHORS   Adams,D.J., Barlas,B., McIntyre,R.E., Salguero,I., van der
            Weyden,L., Barros,A., Vicente,J.R., Karimpour,N., Haider,A.,
            Ranzani,M., Turner,G., Thompson,N.A., Harle,V., Olvera-Leon,R.,
            Robles-Espinoza,C.D., Speak,A.O., Geisler,N., Weninger,W.J.,
            Geyer,S.H., Hewinson,J., Karp,N.A., Fu,B., Yang,F., Kozik,Z.,
            Choudhary,J., Yu,L., van Ruiten,M.S., Rowland,B.D., Lelliott,C.J.,
            Del Castillo Velasco-Herrera,M., Verstraten,R., Bruckner,L.,
            Henssen,A.G., Rooimans,M.A., de Lange,J., Mohun,T.J., Arends,M.J.,
            Kentistou,K.A., Coelho,P.A., Zhao,Y., Zecchini,H., Perry,J.R.B.,
            Jackson,S.P. and Balmus,G.
  CONSRTM   Sanger Mouse Genetics Project
  TITLE     Genetic determinants of micronucleus formation in vivo
  JOURNAL   Nature 627 (8002), 130-136 (2024)
   PUBMED   38355793
REFERENCE   2  (bases 1 to 962)
  AUTHORS   Hauswirth,G.M., Garside,V.C., Wong,L.S.F., Bildsoe,H., Manent,J.,
            Chang,Y.C., Nefzger,C.M., Firas,J., Chen,J., Rossello,F.J.,
            Polo,J.M. and McGlinn,E.
  TITLE     Breaking constraint of mammalian axial formulae
  JOURNAL   Nat Commun 13 (1), 243 (2022)
   PUBMED   35017475
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 962)
  AUTHORS   Fernandez-Guerrero,M., Yakushiji-Kaminatsui,N., Lopez-Delisle,L.,
            Zdral,S., Darbellay,F., Perez-Gomez,R., Bolt,C.C.,
            Sanchez-Martin,M.A., Duboule,D. and Ros,M.A.
  TITLE     Mammalian-specific ectodermal enhancers control the expression of
            Hoxc genes in developing nails and hair follicles
  JOURNAL   Proc Natl Acad Sci U S A 117 (48), 30509-30519 (2020)
   PUBMED   33199643
REFERENCE   4  (bases 1 to 962)
  AUTHORS   Higashijima,Y., Nagai,N., Yamamoto,M., Kitazawa,T., Kawamura,Y.K.,
            Taguchi,A., Nakada,N., Nangaku,M., Furukawa,T., Aburatani,H.,
            Kurihara,H., Wada,Y. and Kanki,Y.
  TITLE     Lysine demethylase 7a regulates murine anterior-posterior
            development by modulating the transcription of Hox gene cluster
  JOURNAL   Commun Biol 3 (1), 725 (2020)
   PUBMED   33257809
  REMARK    Publication Status: Online-Only
REFERENCE   5  (bases 1 to 962)
  AUTHORS   Sato,T., Kataoka,K., Ito,Y., Yokoyama,S., Inui,M., Mori,M.,
            Takahashi,S., Akita,K., Takada,S., Ueno-Kudoh,H. and Asahara,H.
  TITLE     Lin28a/let-7 pathway modulates the Hox code via Polycomb regulation
            during axial patterning in vertebrates
  JOURNAL   Elife 9, e53608 (2020)
   PUBMED   32479258
  REMARK    Publication Status: Online-Only
REFERENCE   6  (bases 1 to 962)
  AUTHORS   Shang,L., Pruett,N.D. and Awgulewitsch,A.
  TITLE     Hoxc12 expression pattern in developing and cycling murine hair
            follicles
  JOURNAL   Mech Dev 113 (2), 207-210 (2002)
   PUBMED   11960714
REFERENCE   7  (bases 1 to 962)
  AUTHORS   Peterson,R.L., Papenbrock,T., Davda,M.M. and Awgulewitsch,A.
  TITLE     The murine Hoxc cluster contains five neighboring AbdB-related Hox
            genes that show unique spatially coordinated expression in
            posterior embryonic subregions
  JOURNAL   Mech Dev 47 (3), 253-260 (1994)
   PUBMED   7848872
REFERENCE   8  (bases 1 to 962)
  AUTHORS   Bradshaw,M.S. and Ruddle,F.H.
  TITLE     Identification of the murine Hox-c12 and Hox-c13 homeoboxes on
            yeast artificial chromosomes
  JOURNAL   Genomics 22 (1), 234-236 (1994)
   PUBMED   7959778
REFERENCE   9  (bases 1 to 962)
  AUTHORS   Brannan,C.I., Gilbert,D.J., Ceci,J.D., Matsuda,Y., Chapman,V.M.,
            Mercer,J.A., Eisen,H., Johnston,L.A., Copeland,N.G. and
            Jenkins,N.A.
  TITLE     An interspecific linkage map of mouse chromosome 15 positioned with
            respect to the centromere
  JOURNAL   Genomics 13 (4), 1075-1081 (1992)
   PUBMED   1354638
REFERENCE   10 (bases 1 to 962)
  AUTHORS   Singh,G., Kaur,S., Stock,J.L., Jenkins,N.A., Gilbert,D.J.,
            Copeland,N.G. and Potter,S.S.
  TITLE     Identification of 10 murine homeobox genes
  JOURNAL   Proc Natl Acad Sci U S A 88 (23), 10706-10710 (1991)
   PUBMED   1683707
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            BC120845.1.
            
            On Feb 16, 2019 this sequence version replaced NM_010463.1.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC120847.1, AF448482.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN01164137, SAMN01164142
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
            COMPLETENESS: complete on the 5' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-962               BC120845.1         70-1031
FEATURES             Location/Qualifiers
     source          1..962
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /db_xref="taxon:10090"
                     /chromosome="15"
                     /map="15 58.01 cM"
     gene            1..962
                     /gene="Hoxc12"
                     /gene_synonym="Hox-3.8"
                     /note="homeobox C12"
                     /db_xref="GeneID:15421"
                     /db_xref="MGI:MGI:96194"
     exon            1..631
                     /gene="Hoxc12"
                     /gene_synonym="Hox-3.8"
                     /inference="alignment:Splign:2.1.0"
     CDS             28..870
                     /gene="Hoxc12"
                     /gene_synonym="Hox-3.8"
                     /note="homeobox protein Hox-3.8; homeo box C12; Homeobox
                     protein Hox-C12 (Hox-3F)"
                     /codon_start=1
                     /product="homeobox protein Hox-C12"
                     /protein_id="NP_034593.1"
                     /db_xref="CCDS:CCDS27891.1"
                     /db_xref="GeneID:15421"
                     /db_xref="MGI:MGI:96194"
                     /translation="
MGEHNLLNPGFVGPLVNIHTGDTFYFPNFRASGAQLPGLPSLSYPRRDNVCSLPWPSAEPCNGYPQPYLGSPVSLNPPFGRTCELARVEDSKGYYREPCAEGGGGGLKREERGREPGAGPGAALLQLEPSGPPALGFKYDYTASGGGGDGSTGPPHDPPSCQSLESDSSSSLLNEGNKSASAGDPGSLVSPLNPGGGLSASGAPWYPIHSRSRKKRKPYSKLQLAELEGEFLVNEFITRQRRRELSDRLNLSDQQVKIWFQNRRMKKKRLLLREQALSFF"
     misc_feature    310..663
                     /gene="Hoxc12"
                     /gene_synonym="Hox-3.8"
                     /note="propagated from UniProtKB/Swiss-Prot (Q8K5B8.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    664..834
                     /gene="Hoxc12"
                     /gene_synonym="Hox-3.8"
                     /note="Region: Homeodomain; pfam00046"
                     /db_xref="CDD:459649"
     exon            632..962
                     /gene="Hoxc12"
                     /gene_synonym="Hox-3.8"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
agaagcagccggtcgggccccgcggaaatgggcgagcataatctcctgaatcctgggtttgtggggccgctggtgaatatccacacaggagacaccttctacttccccaacttccgcgcgtcaggggcacaactcccggggctgccttcgctgtcctacccacgccgcgacaacgtgtgctcgctgccttggccgtcggccgagccgtgcaatggctacccacagccctatctcggcagtcccgtgtctctcaacccgcctttcggccgcacgtgcgagttggctcgcgtggaggatagcaagggttactaccgagaaccctgcgctgagggcggcggcgggggcctaaagcgggaggagcgcgggcgcgaacccggagcgggacccggggcagcgctactgcagctggagccgtcggggccacctgcgctcggcttcaagtacgactacacggcgagcggcggcggtggcgacggcagcacgggacccccccacgatccaccctcgtgccagtcactggaatccgactccagttcgtccctactcaacgagggcaataagagcgccagcgctggtgaccctggctctctggtttcgccgttgaacccaggcggcgggctctcagccagcggcgcgccctggtacccgatccacagccgctcgcgaaagaagcgcaagccgtattcgaagttgcagctggctgagctggagggcgagtttctggtcaacgagttcatcacacgccagcgtcggagggaactctcggaccgcttgaatcttagtgatcagcaggtcaagatttggttccagaaccggagaatgaaaaagaaaagacttctgctgagggagcaagctctctccttcttctagggagcaggacaagcgtgctagccccagactaagcttgccttggtggagcaagagggggcgcagcctgggacatagtcccgcttacaacgcca
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]