LOCUS       NM_007867               1820 bp    mRNA    linear   ROD 02-MAY-2024
DEFINITION  Mus musculus distal-less homeobox 4 (Dlx4), mRNA.
ACCESSION   NM_007867
VERSION     NM_007867.4
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 1820)
  AUTHORS   Adams,D.J., Barlas,B., McIntyre,R.E., Salguero,I., van der
            Weyden,L., Barros,A., Vicente,J.R., Karimpour,N., Haider,A.,
            Ranzani,M., Turner,G., Thompson,N.A., Harle,V., Olvera-Leon,R.,
            Robles-Espinoza,C.D., Speak,A.O., Geisler,N., Weninger,W.J.,
            Geyer,S.H., Hewinson,J., Karp,N.A., Fu,B., Yang,F., Kozik,Z.,
            Choudhary,J., Yu,L., van Ruiten,M.S., Rowland,B.D., Lelliott,C.J.,
            Del Castillo Velasco-Herrera,M., Verstraten,R., Bruckner,L.,
            Henssen,A.G., Rooimans,M.A., de Lange,J., Mohun,T.J., Arends,M.J.,
            Kentistou,K.A., Coelho,P.A., Zhao,Y., Zecchini,H., Perry,J.R.B.,
            Jackson,S.P. and Balmus,G.
  CONSRTM   Sanger Mouse Genetics Project
  TITLE     Genetic determinants of micronucleus formation in vivo
  JOURNAL   Nature 627 (8002), 130-136 (2024)
   PUBMED   38355793
REFERENCE   2  (bases 1 to 1820)
  AUTHORS   Quilez,S., Dumontier,E., Baim,C., Kam,J. and Cloutier,J.F.
  TITLE     Loss of Neogenin alters branchial arch development and leads to
            craniofacial skeletal defects
  JOURNAL   Front Cell Dev Biol 12, 1256465 (2024)
   PUBMED   38404688
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 1820)
  AUTHORS   Qu,F., Li,W., Xu,J., Zhang,R., Ke,J., Ren,X., Meng,X., Qin,L.,
            Zhang,J., Lu,F., Zhou,X., Luo,X., Zhang,Z., Wang,M., Wu,G., Pei,D.,
            Chen,J., Cui,G., Suo,S. and Peng,G.
  TITLE     Three-dimensional molecular architecture of mouse organogenesis
  JOURNAL   Nat Commun 14 (1), 4599 (2023)
   PUBMED   37524711
  REMARK    Publication Status: Online-Only
REFERENCE   4  (bases 1 to 1820)
  AUTHORS   Vanyai,H.K., Garnham,A., May,R.E., McRae,H.M., Collin,C.,
            Wilcox,S., Smyth,G.K., Thomas,T. and Voss,A.K.
  TITLE     MOZ directs the distal-less homeobox gene expression program during
            craniofacial development
  JOURNAL   Development 146 (14) (2019)
   PUBMED   31340933
  REMARK    Publication Status: Online-Only
REFERENCE   5  (bases 1 to 1820)
  AUTHORS   Johnson,J.A., Watson,J.K., Nikolic,M.Z. and Rawlins,E.L.
  TITLE     Fank1 and Jazf1 promote multiciliated cell differentiation in the
            mouse airway epithelium
  JOURNAL   Biol Open 7 (4) (2018)
   PUBMED   29661797
  REMARK    Publication Status: Online-Only
REFERENCE   6  (bases 1 to 1820)
  AUTHORS   Toresson,H., Mata de Urquiza,A., Fagerstrom,C., Perlmann,T. and
            Campbell,K.
  TITLE     Retinoids are produced by glia in the lateral ganglionic eminence
            and regulate striatal neuron differentiation
  JOURNAL   Development 126 (6), 1317-1326 (1999)
   PUBMED   10021349
REFERENCE   7  (bases 1 to 1820)
  AUTHORS   Quinn,L.M., Johnson,B.V., Nicholl,J., Sutherland,G.R. and
            Kalionis,B.
  TITLE     Isolation and identification of homeobox genes from the human
            placenta including a novel member of the Distal-less family, DLX4
  JOURNAL   Gene 187 (1), 55-61 (1997)
   PUBMED   9073066
REFERENCE   8  (bases 1 to 1820)
  AUTHORS   Nakamura,S., Stock,D.W., Wydner,K.L., Bollekens,J.A., Takeshita,K.,
            Nagai,B.M., Chiba,S., Kitamura,T., Freeland,T.M., Zhao,Z.,
            Minowada,J., Lawrence,J.B., Weiss,K.M. and Ruddle,F.H.
  TITLE     Genomic analysis of a new mammalian distal-less gene: Dlx7
  JOURNAL   Genomics 38 (3), 314-324 (1996)
   PUBMED   8975708
REFERENCE   9  (bases 1 to 1820)
  AUTHORS   Weiss,K.M., Ruddle,F.H. and Bollekens,J.
  TITLE     Dlx and other homeobox genes in the morphological development of
            the dentition
  JOURNAL   Connect Tissue Res 32 (1-4), 35-40 (1995)
   PUBMED   7554933
REFERENCE   10 (bases 1 to 1820)
  AUTHORS   Robinson,G.W., Wray,S. and Mahon,K.A.
  TITLE     Spatially restricted expression of a member of a new family of
            murine Distal-less homeobox genes in the developing forebrain
  JOURNAL   New Biol 3 (12), 1183-1194 (1991)
   PUBMED   1687503
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            AL645850.6.
            
            On Apr 8, 2008 this sequence version replaced NM_007867.3.
            
            Sequence Note: This RefSeq record was created from genomic sequence
            data because no single transcript was available for the full length
            of the gene. The extent of this transcript is supported by
            transcript alignments and orthologous data.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AK145123.1, U73329.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN00849375, SAMN00849384
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on conservation, expression,
                                      longest protein
            ##RefSeq-Attributes-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-606               AL645850.6         14840-15445         c
            607-797             AL645850.6         11433-11623         c
            798-1820            AL645850.6         10091-11113         c
FEATURES             Location/Qualifiers
     source          1..1820
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /db_xref="taxon:10090"
                     /chromosome="11"
                     /map="11 59.01 cM"
     gene            1..1820
                     /gene="Dlx4"
                     /gene_synonym="Dlx-4; Dlx7"
                     /note="distal-less homeobox 4"
                     /db_xref="GeneID:13394"
                     /db_xref="MGI:MGI:94904"
     exon            1..606
                     /gene="Dlx4"
                     /gene_synonym="Dlx-4; Dlx7"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    288..290
                     /gene="Dlx4"
                     /gene_synonym="Dlx-4; Dlx7"
                     /note="upstream in-frame stop codon"
     CDS             321..1043
                     /gene="Dlx4"
                     /gene_synonym="Dlx-4; Dlx7"
                     /note="homeobox protein DLX-7; distal-less homeo box 7;
                     DII D"
                     /codon_start=1
                     /product="homeobox protein DLX-4"
                     /protein_id="NP_031893.3"
                     /db_xref="CCDS:CCDS25273.1"
                     /db_xref="GeneID:13394"
                     /db_xref="MGI:MGI:94904"
                     /translation="

MTSLPCPLPDRGASNVVFPDLAPALSVVAAYPLGLSPGTAASPDLSYSQSYGHPRSYSHPGPATPGDSYLPRQQQLVAPSQPFHRPAEHPQELEAESEKLALSLVPSQQQSLTRKLRKPRTIYSSLQLQHLNQRFQHTQYLALPERAQLAAQLGLTQTQVKIWFQNKRSKYKKLLKQSSGEPEEDFSGRPPSLSPHSPALPFIWGLPKADTLPSSGYDNSHFGAWYQHRSPDVLALPQMM"

     misc_feature    450..530
                     /gene="Dlx4"
                     /gene_synonym="Dlx-4; Dlx7"
                     /note="propagated from UniProtKB/Swiss-Prot (P70436.2);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    669..839
                     /gene="Dlx4"
                     /gene_synonym="Dlx-4; Dlx7"
                     /note="Region: Homeodomain; pfam00046"
                     /db_xref="CDD:459649"
     misc_feature    843..902
                     /gene="Dlx4"
                     /gene_synonym="Dlx-4; Dlx7"
                     /note="propagated from UniProtKB/Swiss-Prot (P70436.2);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     exon            607..797
                     /gene="Dlx4"
                     /gene_synonym="Dlx-4; Dlx7"
                     /inference="alignment:Splign:2.1.0"
     exon            798..1820
                     /gene="Dlx4"
                     /gene_synonym="Dlx-4; Dlx7"
                     /inference="alignment:Splign:2.1.0"
     regulatory      1791..1796
                     /regulatory_class="polyA_signal_sequence"
                     /gene="Dlx4"
                     /gene_synonym="Dlx-4; Dlx7"
                     /note="hexamer: ATTAAA"
     polyA_site      1817
                     /gene="Dlx4"
                     /gene_synonym="Dlx-4; Dlx7"
                     /note="major polyA site"
ORIGIN      

aacacgaggggtggggggcgggctcagcttgaggtcaccaaggaatagccaatccggggtgtctaagtgggcgggggacccctggggtcccgggaaccgaacccagaggaaaagatggggaagggtaaaaccacggggtaccccaaaaaaccctttcccgggtgcgagttctctgccggaagaggctcagagagacatttttccaggcatctgaagtgtaagagtggcttgctggagctggagactttgaaaggagctggcagaaagagtagacagcgtgcgggccatgacctaggccctgtggcccggcaccggccgcaatgacctctttaccctgtccccttcctgaccgtggtgcctccaacgttgtcttcccggacctcgcccccgccctgtcggtagtggctgcttacccgctcggactatccccgggaaccgcagcttctcccgatttgtcctactcccagtcctacggccacccccggtcctattcccaccctgggccggcaaccccaggagactcctacctgccccgccagcaacaattggtggcgccatctcagccctttcacaggccggctgaacacccgcaggagctcgaagcagaatcagagaagctggcactgtctctggtgccctcccagcagcagtccctgaccaggaagctgcgcaagcccagaaccatctactctagcctgcagctccaacacctgaaccagcgtttccagcacacccaatacctggccctgcccgagagagctcagctggcagcacaactcggactcacccaaacccaggtaaagatctggtttcagaacaaacgctccaaatataagaagctcctgaaacagagctctggggagccggaagaggacttctctgggagacccccctccctgtctccccactctccagccctaccattcatctggggtctacccaaggcagacaccctgccttccagtggctatgacaacagccactttggtgcctggtatcagcatcgctccccagatgtgctggcactgcctcagatgatgtgagtctggagggaggctggtcagacttcagccctcctgtcaagcccaggacccgagcacctgctccccttctgggaggagaggaaaccagctccagatggattttctcagaagacaagacaccgaaggagaaaaagggaaagaatggtgtggaagcctggctctccaaagcagagagttagatcaggggctttggacggccacaatcttgccactccctctccttcaaatgactgcagccccaagcacagccctaggatccaaaccaggaagaaaacaaatattattcctggcctgcaccatgggggcccagacagcccttccaggaacaaaaccagaagtggacacagggtctgtgttgttggccaccatagagtctccgactttcatttactaattactggtggtggcccagtggtagagtgagtgtttaacatgtaaaaggccccagctccaaagcaaaacttgtggacctgtgggcagcttgtgcttctccgctttaaacggctctctagcgccatatctacccattttgaattgatagccatgggcttaatcgtccatataattcaacagtatgtattaagagcctaggcccacgactctccatccttaacacctaacaagttcacctgcacacattgttggaagcccagaaggagaaatgggacaaacagattaccaggatcagtgcaggcatagctcctcgctgttgcctcgatcaaagaaactgctctcaaatcacaagctattaaaatgtatatatgtattaaaaaagaa

//