2025-01-31 02:22:22, GGRNA.v2 : RefSeq release 227 (Nov, 2024)
LOCUS NM_001426139 1288 bp mRNA linear ROD 15-JUN-2024 DEFINITION Mus musculus B cell receptor associated protein 31 (Bcap31), transcript variant 3, mRNA. ACCESSION NM_001426139 XM_011247600 VERSION NM_001426139.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE 1 (bases 1 to 1288) AUTHORS Zhao,B., An,F., Hao,Z., Zhang,W. and Wang,B. TITLE BAP31 Plays an Essential Role in Mouse B Cell Development via Regulation of BCR Signaling JOURNAL Int J Mol Sci 25 (9), 4962 (2024) PUBMED 38732181 REMARK GeneRIF: BAP31 Plays an Essential Role in Mouse B Cell Development via Regulation of BCR Signaling. Publication Status: Online-Only REFERENCE 2 (bases 1 to 1288) AUTHORS Zhao,B., Sun,L., Yuan,Q., Hao,Z., An,F., Zhang,W., Zhu,X. and Wang,B. TITLE BAP31 Knockout in Macrophages Affects CD4+T Cell Activation through Upregulation of MHC Class II Molecule JOURNAL Int J Mol Sci 24 (17), 13476 (2023) PUBMED 37686286 REMARK GeneRIF: BAP31 Knockout in Macrophages Affects CD4[+]T Cell Activation through Upregulation of MHC Class II Molecule. Publication Status: Online-Only REFERENCE 3 (bases 1 to 1288) AUTHORS Wei,X., Li,L., Zhao,J., Huo,Y., Hu,X., Lu,J., Pi,J., Zhang,W., Xu,L., Yao,Y. and Xu,J. TITLE BAP31 depletion inhibited adipogenesis, repressed lipolysis and promoted lipid droplets abnormal growth via attenuating Perilipin1 proteasomal degradation JOURNAL Int J Biol Sci 19 (6), 1713-1730 (2023) PUBMED 37063427 REMARK GeneRIF: BAP31 depletion inhibited adipogenesis, repressed lipolysis and promoted lipid droplets abnormal growth via attenuating Perilipin1 proteasomal degradation. Publication Status: Online-Only REFERENCE 4 (bases 1 to 1288) AUTHORS Li,G., Jiang,X., Liang,X., Hou,Y., Zang,J., Zhu,B., Jia,C., Niu,K., Liu,X., Xu,X., Jiang,R. and Wang,B. TITLE BAP31 regulates the expression of ICAM-1/VCAM-1 via MyD88/NF-kappaB pathway in acute lung injury mice model JOURNAL Life Sci 313, 121310 (2023) PUBMED 36549351 REMARK GeneRIF: BAP31 regulates the expression of ICAM-1/VCAM-1 via MyD88/NF-kappaB pathway in acute lung injury mice model. REFERENCE 5 (bases 1 to 1288) AUTHORS Li,G.X., Jiang,X.H., Zang,J.N., Zhu,B.Z., Jia,C.C., Niu,K.W., Liu,X., Jiang,R. and Wang,B. TITLE B-cell receptor associated protein 31 deficiency decreases the expression of adhesion molecule CD11b/CD18 and PSGL-1 in neutrophils to ameliorate acute lung injury JOURNAL Int J Biochem Cell Biol 152, 106299 (2022) PUBMED 36210579 REMARK GeneRIF: B-cell receptor associated protein 31 deficiency decreases the expression of adhesion molecule CD11b/CD18 and PSGL-1 in neutrophils to ameliorate acute lung injury. REFERENCE 6 (bases 1 to 1288) AUTHORS Pang,A.L., Taylor,H.C., Johnson,W., Alexander,S., Chen,Y., Su,Y.A., Li,X., Ravindranath,N., Dym,M., Rennert,O.M. and Chan,W.Y. TITLE Identification of differentially expressed genes in mouse spermatogenesis JOURNAL J Androl 24 (6), 899-911 (2003) PUBMED 14581517 REFERENCE 7 (bases 1 to 1288) AUTHORS Schamel,W.W., Kuppig,S., Becker,B., Gimborn,K., Hauri,H.P. and Reth,M. TITLE A high-molecular-weight complex of membrane proteins BAP29/BAP31 is involved in the retention of membrane-bound IgD in the endoplasmic reticulum JOURNAL Proc Natl Acad Sci U S A 100 (17), 9861-9866 (2003) PUBMED 12886015 REMARK GeneRIF: A high-molecular-weight complex of membrane proteins BAP29/BAP31 is involved in the retention of membrane-bound IgD in the endoplasmic reticulum. REFERENCE 8 (bases 1 to 1288) AUTHORS Bell,A.W., Ward,M.A., Blackstock,W.P., Freeman,H.N., Choudhary,J.S., Lewis,A.P., Chotai,D., Fazel,A., Gushue,J.N., Paiement,J., Palcy,S., Chevet,E., Lafreniere-Roula,M., Solari,R., Thomas,D.Y., Rowley,A. and Bergeron,J.J. TITLE Proteomics characterization of abundant Golgi membrane proteins JOURNAL J Biol Chem 276 (7), 5152-5165 (2001) PUBMED 11042173 REFERENCE 9 (bases 1 to 1288) AUTHORS Adachi,T., Schamel,W.W., Kim,K.M., Watanabe,T., Becker,B., Nielsen,P.J. and Reth,M. TITLE The specificity of association of the IgD molecule with the accessory proteins BAP31/BAP29 lies in the IgD transmembrane sequence JOURNAL EMBO J 15 (7), 1534-1541 (1996) PUBMED 8612576 REFERENCE 10 (bases 1 to 1288) AUTHORS Kim,K.M., Adachi,T., Nielsen,P.J., Terashima,M., Lamers,M.C., Kohler,G. and Reth,M. TITLE Two new proteins preferentially associated with membrane immunoglobulin D JOURNAL EMBO J 13 (16), 3793-3800 (1994) PUBMED 8070407 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AL805924.5. On Dec 6, 2023 this sequence version replaced XM_011247600.4. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: SRR17784650.469928.1, SRR17253013.1376645.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMN01164131, SAMN01164142 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: full length. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-130 AL805924.5 203224-203353 c 131-266 AL805924.5 201685-201820 c 267-367 AL805924.5 199337-199437 c 368-515 AL805924.5 193889-194036 c 516-651 AL805924.5 176439-176574 c 652-772 AL805924.5 175552-175672 c 773-873 AL805924.5 174729-174829 c 874-1288 AL805924.5 173073-173487 c FEATURES Location/Qualifiers source 1..1288 /organism="Mus musculus" /mol_type="mRNA" /strain="C57BL/6" /db_xref="taxon:10090" /chromosome="X" /map="X 37.38 cM" gene 1..1288 /gene="Bcap31" /gene_synonym="Bap31" /note="B cell receptor associated protein 31" /db_xref="GeneID:27061" /db_xref="MGI:MGI:1350933" exon 1..130 /gene="Bcap31" /gene_synonym="Bap31" /inference="alignment:Splign:2.1.0" exon 131..266 /gene="Bcap31" /gene_synonym="Bap31" /inference="alignment:Splign:2.1.0" CDS 175..912 /gene="Bcap31" /gene_synonym="Bap31" /note="isoform a is encoded by transcript variant 3; accessory protein BAP31; p28; BCR-associated protein 31" /codon_start=1 /product="B-cell receptor-associated protein 31 isoform a" /protein_id="NP_001413068.1" /db_xref="GeneID:27061" /db_xref="MGI:MGI:1350933" /translation="
MSLQWTTVATFLYAEVFAVLLLCIPFISPKRWQKVFKSRLVELVVTYGNTFFVVLIVILVLLVIDAVREILKYDDVTEKVNLQNNPGAMEHFHMKLFRAQRNLYIAGFSLLLSFLLRRLVTLISQQATLLASNEAFKKQAESASEAAKKYMEENDQLKKGAAEDGDKLDIGNTEMKLEENKSLKNDLRKLKDELASTKKKLEKAENEALAMQKQSEGLTKEYDRLLEEHAKLQASVRGPSVKKEE"
misc_feature 193..255 /gene="Bcap31" /gene_synonym="Bap31" /note="propagated from UniProtKB/Swiss-Prot (Q61335.4); transmembrane region" misc_feature 304..366 /gene="Bcap31" /gene_synonym="Bap31" /note="propagated from UniProtKB/Swiss-Prot (Q61335.4); transmembrane region" misc_feature 481..543 /gene="Bcap31" /gene_synonym="Bap31" /note="propagated from UniProtKB/Swiss-Prot (Q61335.4); transmembrane region" misc_feature 664..669 /gene="Bcap31" /gene_synonym="Bap31" /note="Cleavage, by caspase-8. /evidence=ECO:0000255; propagated from UniProtKB/Swiss-Prot (Q61335.4); cleavage site" misc_feature 898..909 /gene="Bcap31" /gene_synonym="Bap31" /note="propagated from UniProtKB/Swiss-Prot (Q61335.4); Region: Di-lysine motif" exon 267..367 /gene="Bcap31" /gene_synonym="Bap31" /inference="alignment:Splign:2.1.0" exon 368..515 /gene="Bcap31" /gene_synonym="Bap31" /inference="alignment:Splign:2.1.0" exon 516..651 /gene="Bcap31" /gene_synonym="Bap31" /inference="alignment:Splign:2.1.0" exon 652..772 /gene="Bcap31" /gene_synonym="Bap31" /inference="alignment:Splign:2.1.0" exon 773..873 /gene="Bcap31" /gene_synonym="Bap31" /inference="alignment:Splign:2.1.0" exon 874..1288 /gene="Bcap31" /gene_synonym="Bap31" /inference="alignment:Splign:2.1.0" regulatory 1270..1275 /regulatory_class="polyA_signal_sequence" /gene="Bcap31" /gene_synonym="Bap31" /note="hexamer: AATAAA" polyA_site 1288 /gene="Bcap31" /gene_synonym="Bap31" /note="major polyA site" ORIGIN
ctctccgacaacagaaacgaagcaagtccgcgtacactacagaagcggccccagccctcccgccaaggcgcctccaagctccacccctgcgtgtccgaagtgtcagaggcgcggcagggggccttcaaccgaaacaagctcccatccctctgttggaaccctttaagtcacaggatgagtttgcagtggactacagttgccaccttcctctacgcagaggtctttgctgtgttgcttctctgcattcccttcatttctccaaaaagatggcagaaggtttttaaatcccggctggtggagttggtagtgacctatggcaacactttctttgtggttctcatcgtcatccttgtactgttggttattgatgctgtacgagagatcctgaaatacgatgatgtgacagaaaaggtgaacctccagaacaatccaggtgccatggagcacttccacatgaagcttttccgtgctcagaggaatctctatattgctggcttttccttgctgctgtccttcctgcttagacgcctggtgactctcatctcccagcaggccacactgctggcctccaatgaagcctttaaaaagcaggcagaaagtgccagtgaggcggccaagaaatacatggaggagaatgatcagctaaagaagggagctgccgaggatggagacaagttggatattgggaatactgaaatgaagttagaggagaacaagagcctgaagaatgacctgaggaagctaaaagatgagctggccagcaccaagaaaaaacttgagaaagctgaaaacgaggctctggctatgcagaagcagtctgagggccttaccaaagaatatgaccgcctgctagaagaacatgccaaactgcaggcatcagtacgtggtccctcagtcaagaaggaggagtaaaggcttggtgtttccctgcctgccgctggcttctacctgacccatgcttactgcttccttggagcccagactatccctctggtacttgggtttattccctacttccccaattttcttccatggcttatagatcattattttggcaccattacacatactgctcttataccaaaagggacctgattgttgtttattcagagtacttttgccactgttctgcctggctagggcactttccactcctggaagtgtagaaaagcactggtgacctggcctgcagtttgaacccctttttattttgcaatgtaccctaaaggaggctgctgtgaagcaggtcaactgttttatcctgaggggaataaatgttgttatgtta
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]