LOCUS       NM_001424962            1912 bp    mRNA    linear   ROD 01-JUL-2024
DEFINITION  Mus musculus TGFB-induced factor homeobox 1 (Tgif1), transcript
            variant 7, mRNA.
ACCESSION   NM_001424962 XM_006524032
VERSION     NM_001424962.1
KEYWORDS    RefSeq.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 1912)
  AUTHORS   Chang,Y.H., Tseng,Y.H., Wang,J.M., Tsai,Y.S. and Huang,H.S.
  TITLE     TG-interacting factor 1 regulates mitotic clonal expansion during
            adipocyte differentiation
  JOURNAL   Biochim Biophys Acta Mol Cell Biol Lipids 1869 (5), 159492 (2024)
   PUBMED   38575107
  REMARK    GeneRIF: TG-interacting factor 1 regulates mitotic clonal expansion
            during adipocyte differentiation.
REFERENCE   2  (bases 1 to 1912)
  AUTHORS   Cong,M., Li,J., Wang,L., Liu,C., Zheng,M., Zhou,Q., Du,M., Ye,X.,
            Feng,M., Ye,Y., Zhang,S., Xu,W., Lu,Y., Wang,C., Xia,Y., Xie,H.,
            Zhang,Y., He,Q., Gong,L., Gu,Y., Sun,H., Zhang,Q., Zhao,J.,
            Ding,F., Gu,X. and Zhou,S.
  TITLE     MircoRNA-25-3p in skin precursor cell-induced Schwann cell-derived
            extracellular vesicles promotes axon regeneration by targeting
            Tgif1
  JOURNAL   Exp Neurol 376, 114750 (2024)
   PUBMED   38492636
  REMARK    GeneRIF: MircoRNA-25-3p in skin precursor cell-induced Schwann
            cell-derived extracellular vesicles promotes axon regeneration by
            targeting Tgif1.
REFERENCE   3  (bases 1 to 1912)
  AUTHORS   Bolamperti,S., Saito,H., Heerdmann,S., Hesse,E. and
            Taipaleenmaki,H.
  TITLE     Tgif1-deficiency impairs cytoskeletal architecture in osteoblasts
            by activating PAK3 signaling
  JOURNAL   Elife 13, 94265 (2024)
   PUBMED   38661167
  REMARK    GeneRIF: Tgif1-deficiency impairs cytoskeletal architecture in
            osteoblasts by activating PAK3 signaling.
            Publication Status: Online-Only
REFERENCE   4  (bases 1 to 1912)
  AUTHORS   Taipaleenmaki,H., Saito,H., Schroder,S., Maeda,M., Mettler,R.,
            Ring,M., Rollmann,E., Gasser,A., Haasper,C., Gehrke,T., Weiss,A.,
            Grimm,S.K. and Hesse,E.
  TITLE     Antagonizing microRNA-19a/b augments PTH anabolic action and
            restores bone mass in osteoporosis in mice
  JOURNAL   EMBO Mol Med 14 (11), e13617 (2022)
   PUBMED   36193848
REFERENCE   5  (bases 1 to 1912)
  AUTHORS   Astanina,E., Doronzo,G., Cora,D., Neri,F., Oliviero,S., Genova,T.,
            Mussano,F., Middonti,E., Vallariello,E., Cencioni,C., Valdembri,D.,
            Serini,G., Limana,F., Foglio,E., Ballabio,A. and Bussolino,F.
  TITLE     The TFEB-TGIF1 axis regulates EMT in mouse epicardial cells
  JOURNAL   Nat Commun 13 (1), 5191 (2022)
   PUBMED   36057632
  REMARK    Publication Status: Online-Only
REFERENCE   6  (bases 1 to 1912)
  AUTHORS   Zhang,X., Friedman,A., Heaney,S., Purcell,P. and Maas,R.L.
  TITLE     Meis homeoproteins directly regulate Pax6 during vertebrate lens
            morphogenesis
  JOURNAL   Genes Dev 16 (16), 2097-2107 (2002)
   PUBMED   12183364
REFERENCE   7  (bases 1 to 1912)
  AUTHORS   Piao,Y., Ko,N.T., Lim,M.K. and Ko,M.S.
  TITLE     Construction of long-transcript enriched cDNA libraries from
            submicrogram amounts of total RNAs by a universal PCR amplification
            method
  JOURNAL   Genome Res 11 (9), 1553-1558 (2001)
   PUBMED   11544199
REFERENCE   8  (bases 1 to 1912)
  AUTHORS   Melhuish,T.A. and Wotton,D.
  TITLE     The interaction of the carboxyl terminus-binding protein with the
            Smad corepressor TGIF is disrupted by a holoprosencephaly mutation
            in TGIF
  JOURNAL   J Biol Chem 275 (50), 39762-39766 (2000)
   PUBMED   10995736
REFERENCE   9  (bases 1 to 1912)
  AUTHORS   Lee,C.K., Klopp,R.G., Weindruch,R. and Prolla,T.A.
  TITLE     Gene expression profile of aging and its retardation by caloric
            restriction
  JOURNAL   Science 285 (5432), 1390-1393 (1999)
   PUBMED   10464095
REFERENCE   10 (bases 1 to 1912)
  AUTHORS   Bertolino,E., Wildt,S., Richards,G. and Clerc,R.G.
  TITLE     Expression of a novel murine homeobox gene in the developing
            cerebellar external granular layer during its proliferation
  JOURNAL   Dev Dyn 205 (4), 410-420 (1996)
   PUBMED   8901052
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            AC079441.37.
            
            On Oct 17, 2023 this sequence version replaced XM_006524032.4.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: SRR13422603.491857.1,
                                           SRR7345562.2889340.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN00849374, SAMN00849375
                                           [ECO:0000348]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-623               AC079441.37        221120-221742       c
            624-850             AC079441.37        218108-218334       c
            851-1912            AC079441.37        216147-217208       c
FEATURES             Location/Qualifiers
     source          1..1912
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="C57BL/6"
                     /db_xref="taxon:10090"
                     /chromosome="17"
                     /map="17 41.87 cM"
     gene            1..1912
                     /gene="Tgif1"
                     /gene_synonym="Tgif"
                     /note="TGFB-induced factor homeobox 1"
                     /db_xref="GeneID:21815"
                     /db_xref="MGI:MGI:1194497"
     exon            1..623
                     /gene="Tgif1"
                     /gene_synonym="Tgif"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    620..622
                     /gene="Tgif1"
                     /gene_synonym="Tgif"
                     /note="upstream in-frame stop codon"
     exon            624..850
                     /gene="Tgif1"
                     /gene_synonym="Tgif"
                     /inference="alignment:Splign:2.1.0"
     CDS             668..1426
                     /gene="Tgif1"
                     /gene_synonym="Tgif"
                     /note="isoform c is encoded by transcript variant 7;
                     homeobox protein TGIF1; 5'-TG-3'-interacting factor 1;
                     TALE family homeobox; TG interacting factor 1"
                     /codon_start=1
                     /product="homeobox protein TGIF1 isoform c"
                     /protein_id="NP_001411891.1"
                     /db_xref="GeneID:21815"
                     /db_xref="MGI:MGI:1194497"
                     /translation="

MDSPLDLSSSAASGKRRRRGNLPKESVQILRDWLYEHRYNAYPSEQEKALLSQQTHLSTLQVCNWFINARRRLLPDMLRKDGKDPNQFTISRRGAKISEASSIEAAMGIKNFMPTLEESPFHSCVVGPNPTLGRPVSPKPPSPGSILARPSVICHTTVTALKDGPFSLCQPIGVGQSTDVPQIAPSNFTDTSLVYPEDTCKSGPSPNPQSGLFNTPPPTPPDLNQDFSGFQLLVDVALKRAAEMELQAKLTA"

     misc_feature    order(713..727,731..733,791..793,809..811,848..850,
                     854..859,866..871,875..883)
                     /gene="Tgif1"
                     /gene_synonym="Tgif"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    order(719..721,728..730,857..859,866..871,878..880)
                     /gene="Tgif1"
                     /gene_synonym="Tgif"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     misc_feature    767..883
                     /gene="Tgif1"
                     /gene_synonym="Tgif"
                     /note="Homeobox KN domain; Region: Homeobox_KN; pfam05920"
                     /db_xref="CDD:428673"
     exon            851..1912
                     /gene="Tgif1"
                     /gene_synonym="Tgif"
                     /inference="alignment:Splign:2.1.0"
     regulatory      1888..1893
                     /regulatory_class="polyA_signal_sequence"
                     /gene="Tgif1"
                     /gene_synonym="Tgif"
                     /note="hexamer: AATAAA"
     polyA_site      1912
                     /gene="Tgif1"
                     /gene_synonym="Tgif"
                     /note="major polyA site"
ORIGIN      

agacctagaccgcgactgcagttccaacggaacacggttatagcagctgccgccaaacacgcttcctcacggggtttctccgcgcttcctaccttagagagttgggtggatgttattctgtgagagaccccgaaacatacggaactcatgaagaccccgggtacttggttaagtaggcctccttgctcctttccaccctgggacagtcagagtgtgggcgctctgagttgggggacagtttaactgagctctggggaaaacttagggatcttctcaagacctctgtcaccccttgacgtggctgacagatctagacccccgtgggaggcattccgctccaatagcacctcaatgagggtagtttggttttgtgtggctccggggtgcgggaatgcaaaactgggtttccgtgggtggggaggaaggctgacgactagcttcccattcaggctccaccctcttgggtgtccccttccccagatgcgaggtccccagcccaaagagcgtgggttccccaagtcaatccccccgactcatggaaacgatgaacggtgacgtgttggagaggaaactttgctgagaccgatttcgagtttctcattgggagagctgagactgctaaggtcttgttgcagcatctggcagtgactctgaggatgaagacagcatggacagtcccctggacctttcctcatcagcagcctctggcaagagaaggaggagaggcaatctgcccaaggagtcagtccagattctgcgagactggctgtatgaacacagatacaacgcctatccctcagagcaagagaaagcactgctgtcccagcagacacacctgtccacactacaggtctgtaactggttcatcaacgcccgccgcaggctccttcctgacatgctgagaaaggatggcaaagatccaaatcagttcacgatttcccgccgtggggccaagatttcagaagctagctctattgaagctgcaatgggtatcaaaaacttcatgccaactctagaagagagcccatttcattcctgcgtagttggacccaacccaaccctagggagaccagtgtctcccaaacctccctccccaggatccattttggctcgcccgtcagtgatctgccataccactgtgactgcattgaaggatgggcctttctctctctgtcagccgattggtgtgggacagagtacagatgtaccgcaaatagcacccagcaactttacagacacctctctcgtgtacccagaggacacttgcaaatctggacccagtccaaaccctcagagtggtcttttcaacactcctccccctactccaccagacctcaaccaggattttagtggattccagcttctagtggatgttgcactcaaacgagcggcagagatggagcttcaggccaaactcacagcttaaccgttttttcaaacaaaacagttctccaaaatacggtcctgattgccgggggtgatggcaagagatgcattattttatatatttttctattaatatttgcacatgggattgctcagacgaagcttcctgttactaagatgtcttaagtggaatagagtcattccaagaactacaaactaaagctactgtagaaacaaagggttttcttttcgaatgtttcttggtagtttctcataatgtgagacggttcccagtatcatgtgatcttctcctccagactcctcttctttatgttccaagactgtgcaatactttagacgccctcgcacctctctcttcccatgtggaatgggacgcccacctacagtctaatgagtaaactttcagttttttgtttgtttgtttttttttagattcaagcaagtatgaatctagttgttggataccttttttcatgatgtaataaagtattttctttaaaagtta

//